KEGG   Linepithema humile (Argentine ant): 105669537Help
Entry
105669537         CDS       T04898                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu00010  Glycolysis / Gluconeogenesis
lhu00030  Pentose phosphate pathway
lhu00051  Fructose and mannose metabolism
lhu00052  Galactose metabolism
lhu01100  Metabolic pathways
lhu01200  Carbon metabolism
lhu01230  Biosynthesis of amino acids
lhu03018  RNA degradation
Module
lhu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105669537
   00030 Pentose phosphate pathway
    105669537
   00051 Fructose and mannose metabolism
    105669537
   00052 Galactose metabolism
    105669537
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    105669537
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lhu01009]
    105669537
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lhu03019]
    105669537
Enzymes [BR:lhu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     105669537
Protein phosphatases and associated proteins [BR:lhu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105669537
Messenger RNA biogenesis [BR:lhu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     105669537
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 105669537
NCBI-ProteinID: XP_012217966
LinkDB All DBs
Position
Unknown
AA seq 994 aa AA seqDB search
MMKTVTWLMTYLSCAPKGFGQLGGIYPSVTQQWHKGHLQSAEQCGDHSVRYRNIESVGVS
SSQLSLSDTHESTVEIQTDLNLTDSIETKYSSQYITCRDMSRQSIAVEALKKTDVDKINR
ISMQNLKLSSIFPEMFWRNNIESVENLPSGSSFEIRFDTFEEEFARSLRFPQFMRQKRFK
EYHRTIMAEDALTQKFIRPGSHKGKGIAVFTSGGDSQGMNAAVRAVVRMGIYLGCRVYFI
REGYQGMVDGGKHIEEATWSSVSCIIHRGGTVIGSARCQEFRERPGRRKAAKNLVNLGIP
NLVVIGGDGSLTGANLFKEEWPELLKELVASGDITAEQSEKNKQLHIVGLVGSIDNDFCG
TDMTIGTDSALHRIIESIDAIVSTAYSHQRTFIMEVMGRHCGYLALVAAICCEADYVFIP
EWPPEQEWPNKLCKKLLQERLTGQRLNIIIVAEGAVDRNGDPITAEKVHKVVVDKLQQDT
RVTVLGHVQRGGNASAFDRVLGCRMGAEAVMALMEATFDTEACVVTLDGNQAVRLPLMEC
VRRTQAVAQAMANKNWDLAVQLRGKGFERNLETYKMLTRLKAPDLDHDVNKEVNGRTLSK
QYTLCGQDNYTLAVMHIGSPSCGMNAAVRSFVRNCIYRGDKVYGICDGVLGLMAGRLKLM
DWPSVTGWVAEGGAKLGTKRSPPQEDQLPQIAQKLKEFGIQALLIIGGFEGFQTCLTFYK
ARNKFEEFQIPIAMIPATISNNVPGTEFSLGCDTALNEITEICDRIRQSAQGTKRRVFII
ETMGGFCGYLATVAGLAGGADAAYIYEEKFNIKDLNQDVISMAAKMSEGVERGLIIRNEN
ANENYNTEFMYRLFSEEGKGLFSCRRNILGHMQQGGSPTPFDRNLGTKMGSKAVEWFSDQ
LRKCTSPDGKTVTTAVNSAVMLGIIKRQYRFTPFTELMEATDFEHRIPMYQWWMKLRPLL
KVLAKHESTYEEEGLYMTVEEMDGKDEQKDPPLV
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagacagtcacgtggttgatgacgtacttatcatgcgcaccaaaaggatttggt
cagcttggtgggatctatccctccgtcacccaacagtggcacaaaggtcaccttcagtcg
gctgaacagtgtggtgatcatagtgttcgttacagaaacattgaaagcgtaggggtatcg
tcgtcgcaattgtcactgtctgatacacatgaaagcactgtagaaattcaaacagattta
aatttaaccgactctattgaaactaaatattcatcacaatacattacatgtagagacatg
tcgagacaatctattgctgttgaagcattgaagaagactgatgtcgataaaataaacagg
atcagtatgcaaaatttaaagctttcctcaatatttccagagatgttctggagaaataat
attgaatcagttgaaaacttaccaagtggttcttcgttcgagataagatttgacacattt
gaggaagaatttgccagaagtttgcgtttcccacaatttatgagacaaaaaaggtttaag
gaatatcatcgtacaatcatggctgaagacgcactaactcaaaaattcataagacctggg
agccacaagggcaaagggattgctgtgttcaccagcggaggtgattctcaaggaatgaat
gctgctgtacgggcagttgtacggatgggtatttatcttggatgcagagtgtattttatt
cgggaaggttatcaaggcatggtagacggtggaaaacacattgaagaagctacatggtca
tctgtatcttgcatcattcatagaggtggcacagtgataggctccgctcgatgccaagaa
ttcagagagcgcccgggtcgtcgaaaagctgctaaaaacttggtcaatcttggcatacct
aatttagtagtgatcggtggagacggttccctcacgggcgccaatctcttcaaggaagaa
tggccggagctgttgaaagaactggttgcgtctggggacataactgccgaacagagcgag
aagaataagcagttgcatattgtcggtctagtaggttccattgacaacgatttctgcggt
acggatatgacgatcggtaccgactccgcgttgcatcgtatcattgaaagtatagatgct
atagttagtacagcttattctcatcagagaacatttataatggaagttatgggtcgtcat
tgtggttatctggctctggtggcagctatatgttgcgaagctgattatgttttcatccca
gaatggccacccgagcaagagtggcccaacaagctgtgcaaaaaattattgcaggaaaga
cttactggtcaacggcttaatattattattgtggctgagggagctgtcgacagaaatggc
gatccgattactgctgagaaagtgcacaaagtagtcgtggacaaattacagcaggatacg
agagttaccgttttaggtcatgtacaaagaggtggcaacgcttcagcttttgatagagtt
ttggggtgccggatgggagctgaagctgtgatggctttaatggaagcaacatttgacaca
gaagcatgtgtcgttacattggacggtaaccaagctgtgagattgccacttatggaatgt
gtgcgtcgtacgcaagctgtggcgcaagctatggctaataagaattgggatcttgccgtt
caactgcgaggaaagggatttgaacgaaatttggaaacttacaaaatgttgactcgtttg
aaagctccagatttagatcacgatgtaaataaggaagttaatggccgtacattatcgaag
caatacactttatgtggacaagataattatacgttggcggttatgcatataggatcaccg
tcttgcggcatgaatgcagcagttcgttccttcgtgagaaattgtatttatcgaggcgat
aaggtgtacggtatctgcgacggagtgttgggtctcatggccggtagattaaaattaatg
gattggccgtctgtcactggctgggttgcggaaggcggcgcaaaattgggaacgaaacgc
tcaccacctcaggaagatcagttaccccaaatcgctcagaaactgaaggaatttggaatt
caagcgttgctcattataggtggatttgagggttttcaaacttgtctcacattttacaaa
gcgagaaataaattcgaggagttccagattcctatcgctatgattcctgcaactatcagc
aataatgtaccgggcactgaattttcattgggttgtgatacagcgttgaatgaaattaca
gagatctgcgatcgtattcggcaatcggcgcaaggtactaagcgccgtgtgtttatcatc
gaaacgatgggcggtttttgcggatacttagcgaccgtcgctggtctagctggtggtgca
gatgcggcgtatatctatgaggagaaatttaacattaaagatttgaatcaagatgtcatt
tcgatggcggcaaagatgtcggagggtgtcgagagaggtctcattatcaggaatgaaaac
gccaatgaaaattacaatacagaatttatgtatagacttttcagcgaggaaggaaagggt
ttattcagttgtaggagaaacatactcggtcatatgcaacaaggtggctcaccgacgcct
ttcgatcgtaacttgggaacaaagatgggctctaaggcggtggaatggttcagcgatcaa
ttaagaaaatgtactagtcctgatggcaaaacggtcactacagcggtgaacagcgcagta
atgctcggtattattaaacgtcaatatagatttacaccattcacggaacttatggaagct
actgattttgagcatcgcattccgatgtatcaatggtggatgaaactacgtcctttgctg
aaggtattggcgaagcatgaatcaacgtacgaagaagaaggcctttatatgactgttgaa
gagatggatggaaaagatgagcagaaggatccgcctcttgtataa

DBGET integrated database retrieval system