KEGG   Linepithema humile (Argentine ant): 105670175Help
Entry
105670175         CDS       T04898                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu00562  Inositol phosphate metabolism
lhu01100  Metabolic pathways
lhu04068  FoxO signaling pathway
lhu04070  Phosphatidylinositol signaling system
lhu04140  Autophagy - animal
lhu04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    105670175
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    105670175
   04070 Phosphatidylinositol signaling system
    105670175
   04150 mTOR signaling pathway
    105670175
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105670175
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lhu01009]
    105670175
Enzymes [BR:lhu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     105670175
    3.1.3.48  protein-tyrosine-phosphatase
     105670175
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     105670175
Protein phosphatases and associated proteins [BR:lhu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    105670175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3 DSPn
Motif
Other DBs
NCBI-GeneID: 105670175
NCBI-ProteinID: XP_012218967
LinkDB All DBs
Position
Unknown
AA seq 606 aa AA seqDB search
MFWELMGICFSCRRPTSGRLNSKISEHISASVTPLHVCLEEQRRPELGSCDASQAHKPQV
KTTFENQKAGEEISVEVAESSSIEIETGELRQNQATMANTISNMKMTNPIKELVSKRRKR
FTEDGFNLDLTYITGNLIAMGFPAEKLESMYRNHIDDVVKLLESKHKDHYKIYNLCSERS
YDCNKFKKRVATYAFDDHNPPKLEQIKPFCEDVHSWLSEHKDNVAVVHCKAGKGRTGVMV
CCYLLHSEQFSTATEALNFYGTKRTHDKKGVTIPSQRRYVDYYATLVQESLSYQPVTLIL
RTIQLDPVPIFNGGQGCLYFAISESKKKILFEDVCEVRKGTSSISISLRHTVALTGDIRV
DFYSRPKMKRQEKMFHFWFNTFFVREKTNSEYDNGELPVERSGRALSCDGTAMELSTVMS
HVKPRTGSLASLGPMPPTLVLRIDKSGLDNAHKDKHHKLYSPDFKVSLFMHCVDGSISSA
VASTAGRSGDSVHEAIGTSGQETPSESSEAESSECDTTGDEDGWESGESSASLVVNHHHE
HQQHHLLTHSSSRTHVSNVRPRASLKETAKGLLRGDKNRSSNRQSATGAIAKRSSAPLAR
SATLDT
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgttctgggaattgatgggtatatgcttttcctgcaggagacccaccagtggcaggttg
aacagtaaaatctctgaacatatctcggcatcagtaactcctctccatgtttgtctggag
gaacaaagaagaccagaactgggctcatgtgacgcttcgcaagctcacaagcctcaggtt
aaaacgacctttgagaatcaaaaagcaggagaagagatctccgtggaagtggcggagagt
agttcgatcgagatcgagacaggagagttaagacagaatcaggcaaccatggccaatacg
atcagtaacatgaagatgaccaaccccataaaagaacttgtcagcaaacgtcgtaaacgt
tttacagaagatggttttaatcttgatctcacatatataacgggtaatttaatagcgatg
ggttttcctgctgagaaactggagagtatgtacagaaatcatattgatgacgttgttaaa
ctgctagagtccaaacacaaagaccattacaagatttataatctgtgttccgagagatcg
tacgattgcaacaagtttaagaagagagtggccacttatgcgtttgatgatcacaaccca
ccaaagctggagcagatcaagccattctgcgaggatgtacactcatggctgtccgaacac
aaagacaatgtggctgtagtccattgtaaggcggggaaaggtcgaacgggtgtaatggtg
tgctgctatctacttcacagtgaacagttttccactgccacagaagcccttaatttttac
ggaaccaaacggactcacgataagaaaggcgttacgataccctcgcaaagaagatatgtg
gattattatgctacccttgtccaagagagtctcagttatcagccagtgacgttaattcta
cgtacgatacaactggatccggtccctattttcaatggcggtcaaggctgtctctatttt
gcaatctcggaatcaaagaaaaagattctattcgaggatgtttgcgaggttcgaaagggt
acatcgtctataagcatctcattacgacacacagtcgccctaacgggagatatacgggta
gatttttacagcaggccaaagatgaaacgacaagaaaagatgtttcatttttggtttaat
acatttttcgtccgcgaaaaaacgaattccgagtacgacaatggcgaattacctgttgaa
agatcgggaagagcattgagttgcgatggcacggccatggaattgtcgacggttatgtca
cacgtaaaacctagaacgggatcattggcgagtcttggtcccatgccgcccactcttgtt
ttacggatagacaagtcaggattggacaatgcacacaaggataaacatcacaagttgtac
agtccagattttaaagtgagtctatttatgcattgcgtggacgggagcatatcgtcggcc
gtggcatcgacggcgggcagaagtggggacagcgtacacgaggcgataggcacgagcggg
caggagacgccgagcgagtcgagcgaggcggagagcagcgagtgcgacaccaccggcgac
gaggacggttgggaatccggtgagtcctctgcatccctggtggtaaaccaccaccacgaa
caccaacaacaccacctccttacacacagcagtagccgtacacacgttagcaatgtccgt
ccgcgggccagtctcaaggagaccgccaagggtttattgcgcggcgacaagaacagaagc
agtaacaggcagagcgctaccggcgcgatagcgaagcgttcctccgctccgctcgcgcgc
tcagccactctcgacacatag

DBGET integrated database retrieval system