KEGG   Linepithema humile (Argentine ant): 105670714Help
Entry
105670714         CDS       T04898                                 

Definition
(RefSeq) alpha-amylase A
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu00500  Starch and sucrose metabolism
lhu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    105670714
Enzymes [BR:lhu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     105670714
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase Alpha-amylase_C
Motif
Other DBs
NCBI-GeneID: 105670714
NCBI-ProteinID: XP_012219816
LinkDB All DBs
Position
Unknown
AA seq 493 aa AA seqDB search
MRILVCALTILSAVAAQKDTHYAPGHDGMVHLFEWKWNDIAVECERFLGPHGFGGVQVSP
IQENVIVPNRPWWERYQPISYIWHTRSGTPQEFKDMVRRCNNVNVRIFVDVVFNHMTGNH
QDAKGTGGSTANTFNFSYPAVPYTHADFHYPPCPINNYNDEFNVRYCELSGLHDLNQSKE
HVREKIVNFLNEVIDAGVAGIRVDAAKHMWPHDLKVIFSRLKNLNTDHGYPAGTRPYIVQ
EVIDYGSNEAVKKYEYNSFGAVTEFTYGMKISNALRGGDQIRWFRNWGEEWGMLPSKDAL
VFIDNHDTQRGNSAILNYKSAKLYKMAVAFMLAHPYGVPRIMSSFAFDNFDASPPQDASG
NLLSPIINSDLTCGNGWVCEHRWRQIYNMVHFRNAVNQTNVGFWWDNGWNQAAFCRGNRG
FFAINNDSNDLKQNLFTCLRPGTYCDVISGSVENNKCTGKVVKVGQDSRAYIEILKHEED
GVLAIHELAKLKD
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatactggtatgtgcattaacaatattgtcggcggtagccgcacagaaggatact
cactatgcacccggccacgatggcatggtgcatctgtttgagtggaaatggaatgatatc
gcggtagagtgtgaaaggtttctcggtcctcatggattcggtggcgtacaggtttcgccg
atccaagaaaacgtaattgtacccaatagaccgtggtgggaacgttatcaacctatatct
tacatctggcacacgagatcgggtacgccacaggaattcaaggatatggttcgcaggtgt
aacaacgtcaacgtgagaattttcgtcgacgtagtgttcaaccacatgactggcaatcat
caagatgcaaagggtaccggcggctcgacggcgaacacttttaacttcagctatccggca
gtgccgtacacacacgctgattttcactatcctccttgtcccatcaacaactacaacgat
gagttcaatgtaagatactgcgaactgtccggtctgcacgatctcaatcagagtaaggag
cacgtcagagagaagattgtcaactttttgaacgaagtcatcgacgctggagtggctggt
atccgagtggatgcagctaaacacatgtggccacatgatctaaaagtgattttctcgcgg
ctgaaaaatctcaataccgatcatggttatcctgcaggcacgcggccttatatagttcaa
gaagtaatcgattacggtagtaacgaagcggtcaaaaaatatgaatacaacagtttcggc
gcggtgacagaattcacatatggcatgaagatcagcaacgccttgaggggaggcgatcaa
ataagatggttccgtaattggggagaagaatggggcatgttaccgtcaaaggacgctctg
gtgttcatcgacaaccatgatactcaacggggcaattccgcaatactgaactacaagtcg
gcgaaattgtataagatggccgttgctttcatgttggcgcatccctacggcgttccgcgt
attatgagctccttcgcttttgacaatttcgacgcgagtccgccgcaagacgcttccggt
aatcttctgtctccgatcatcaattctgacctgacttgcggcaacggctgggtctgcgaa
cacaggtggcgtcagatttacaacatggtgcacttccgaaatgctgtgaatcaaaccaac
gtcggattctggtgggacaacggctggaatcaagccgccttctgccgcggaaatcgcgga
ttcttcgcgatcaacaatgacagcaatgatttgaaacagaatctcttcacctgtctgcga
cccggcacttactgcgacgtcatttccggcagcgtggagaataacaagtgtactggcaaa
gttgtaaaagtgggtcaagacagcagggcctacatagaaattttgaagcacgaggaagat
ggtgtactcgccatccatgaattggcaaagctgaaagactaa

DBGET integrated database retrieval system