KEGG   Linepithema humile (Argentine ant): 105671171Help
Entry
105671171         CDS       T04898                                 

Definition
(RefSeq) glycosyltransferase 25 family member isoform X1
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu00310  Lysine degradation
lhu00514  Other types of O-glycan biosynthesis
lhu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    105671171
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    105671171
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lhu01003]
    105671171
Enzymes [BR:lhu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     105671171
Glycosyltransferases [BR:lhu01003]
 O-Glycan biosynthesis
  O-linked Gal type
   105671171
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4 Anp1
Motif
Other DBs
NCBI-GeneID: 105671171
NCBI-ProteinID: XP_012220533
LinkDB All DBs
Position
Unknown
AA seq 569 aa AA seqDB search
MTFRKYFFVYFFIRYTCLITCDVILKEPTVLIAILVRNKAHTLPYFLSFLEQQDYPKNRI
CLWIRSDNNIDNSIKILNKWIDSEGEKYHYLNIYLNTTTTGFEDERTYADWSPHRFAHVI
NLREEALNYAREIWADFILMLDADVFLTNSSTLRNLVLKEQTIVSPLLRSDGMYSNFWAG
MTAEHYYLRTDLYEPILYREKIGCHNVPMVHSAVLIDLRRYDSDRLSYKSEKLIAYDGPV
DDIITFAVGANKSGVPLHVCNDEAYGFVMVPLENKETIAEDMQRLTNTKAEILAFSDYLP
LSDNLMEFVTYPQKDTLGLDHIYMINLLRRPERRNRMKRLFKEIGILAEIIDAVDGRTLN
ENTLKEWGVAPLPEYLDPYHKRPMTMGEIGCFLSHYVVWQKVLERGYERVMVLEDDVRFE
PFFRQKVNYILAELFDLGTQWDLVYIGRKRLVKSEKPIEDSKVLVHAGYSYWTLGYILSE
SGAKKLVDAKPLGKLIPVDEYLPILANTHPEQQWVAQFPTRDLIMLSADPLLIYPTHYTG
EDGHISDTEDSKLVQNTSAFTELENREEL
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgacctttcgaaaatactttttcgtttatttctttatcagatatacgtgcttaattaca
tgcgatgtgatattgaaggagccgaccgtgctgatcgcaattctagtcaggaacaaagca
cacacgttgccatattttctcagcttcttggagcagcaggattatcctaaaaaccggata
tgtctttggatacgcagcgacaacaatatcgacaattccataaaaattttaaataaatgg
attgattctgaaggcgaaaagtatcattatttgaatatttacttgaatacaacgacgacg
ggatttgaagacgaacggacgtatgcagattggtcccctcacagattcgcgcatgtaata
aatttacgtgaagaagcgctcaattacgcacgagaaatatgggcggactttattttgatg
ctggatgctgatgttttcttgaccaattcgagtactctgcgcaacttagtccttaaggaa
cagaccattgtatcacccttgctgagatcggatggtatgtacagcaatttttgggccggg
atgacagcggagcattattacttgcgaacggatctctacgagccgattttgtaccgtgag
aaaatcggatgtcacaatgtgcctatggttcatagtgcagttctcatcgatttacgacga
tatgactctgatcgtctgagctataagtctgagaaactaattgcatacgatggacctgtg
gacgatatcataacttttgctgtaggagcaaataaatcaggtgtgccattacatgtgtgc
aacgatgaggcctatggcttcgttatggtgccattggagaataaggaaactatcgcggaa
gatatgcaacggttgactaatacgaaggcagaaatattggcatttagcgactatttgccg
ttatcagacaatctgatggaattcgtgacatatccgcagaaggataccttgggtttagat
cacatctacatgattaatctgctgagaagaccggagagacgtaatagaatgaaaagactg
ttcaaagaaatcggcattttagcggaaatcatcgacgccgtggatggtaggactttaaat
gaaaatactttgaaggaatggggtgtggcgccattgccagaatatttggacccttatcac
aagaggccgatgacaatgggcgagattggctgttttctcagtcattacgttgtatggcag
aaggtgctggaacgtggttacgaaagggtcatggtgctggaggacgacgttcgtttcgag
ccattctttcgacagaaagtcaattacattttagcggagctgtttgatcttggaactcag
tgggacttggtatacataggaagaaaacgcttggtgaaatcggagaaaccaatcgaagat
tccaaagttttggttcatgcagggtacagttattggacattaggttacattttatcagaa
agcggggcaaagaaactagttgatgctaagcctctcggaaaattaattccagtcgacgag
tatctccccattcttgcgaatacacatccggagcagcaatgggtggcgcagtttcctact
cgggatttgattatgctatcggcagatccacttctgatttatccgacgcattacaccggc
gaggacgggcacatcagcgatacggaagactcgaagctcgtgcaaaacacttctgcattt
acggagttggaaaatcgagaggaactataa

DBGET integrated database retrieval system