KEGG   Linepithema humile (Argentine ant): 105672201Help
Entry
105672201         CDS       T04898                                 

Definition
(RefSeq) cysteine sulfinic acid decarboxylase
  KO
K01594  sulfinoalanine decarboxylase [EC:4.1.1.29]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu00430  Taurine and hypotaurine metabolism
lhu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    105672201
Enzymes [BR:lhu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.29  sulfinoalanine decarboxylase
     105672201
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 105672201
NCBI-ProteinID: XP_012222395
LinkDB All DBs
Position
Unknown
AA seq 519 aa AA seqDB search
MEGVQQASRRICRLVSWRISLLRFSILFTMAATGSNGTVDLLEKLLQIFKEERVFDRSGD
QPVVQFVQPKDLQEKISCSLNDKPASDEQIEAVIRQAIRYSVKTSSPHFHNQLYAGVDEF
GLAGSWLTETLNTSQYTYEVAPVFTLMEREVIRMSLTLVDYPLMPDADGIMSPGGTISNM
YGMVLARYKKAPEVKKKGVNHLPPLVCFTSEDGHYSIIKAAHWLGLGTDNVYKVKTDELG
RMKPDDLKRLIAKARAAGCTPFFVNATAGTTVLGAIDPLPEIARICQDEGLWLHVDACLG
GTLLLSKKYRPLLQGIELSDSVAWNPHKMLGAPLQCSLFLVKGKNALHNANNASATYLFQ
QDKFYDVSWDTGDKSVQCGRKVDAMKFWLMWKARGTSGFRQSVDHAMSCADYFLKRIKET
TGFRLVLPAYQCCNVCFWYIPPSMREKEENEDWWHKLYVITTTIKKRLTLEGSLLIGYTP
LPQKNIGNFFRMVVNCQPPPTESSMDYVIRQIEKSAADL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggaaggggtccaacaagcgagtcgacggatttgtcgactggtcagttggcggatatcc
ttgcttcgtttcagtatactattcacgatggctgcgacaggtagtaatggtactgtcgat
ttactggagaaactcttgcagatctttaaagaggaacgagtgttcgatcgatctggcgat
caacccgtcgtgcaatttgttcaacccaaagatttgcaggaaaagatttcatgctctttg
aatgataaaccagcgagcgatgagcaaatcgaagcggtaatacgacaagccatacgatat
tctgtgaagacgtccagtcctcattttcataatcagctatatgctggcgttgatgaattc
ggactggctggctcctggttaacggaaaccttgaacactagccagtacacctacgaagtc
gcccccgtatttactttaatggagcgagaagtgatacgaatgtcattgacactggtagac
tacccgctgatgccggatgccgatggtataatgagtccgggtggcaccatatcaaacatg
tatggaatggtgctggccagatacaaaaaagcgccagaagtaaagaaaaaaggagttaac
catttaccaccgctagtgtgttttacgagcgaggatggtcattattcgattataaaagca
gctcactggttgggtttgggcaccgacaatgtttacaaggtgaaaacggacgagcttggt
cgcatgaaaccggatgatctaaagagactcatagcgaaagcgagggctgcgggatgcaca
ccgttctttgtgaacgctaccgctggcactacagtgctcggagctatcgatcctttgcca
gaaattgccagaatttgtcaggatgaaggcctctggctacacgttgatgcttgtctcggc
ggtactctgctgctctcgaagaagtatcggcctctgctgcaaggcatcgaattatcagac
tcggtggcatggaatccgcacaagatgctcggagcaccgttgcagtgctccttgtttcta
gttaaaggcaagaatgcgttgcacaacgcaaacaacgccagtgcaacttacctttttcag
caggacaaattttatgacgtcagttgggatacgggagataagagcgtgcagtgcggcaga
aaggtcgacgcaatgaaattttggttaatgtggaaagctcgcggcacgagtggttttcgg
caatcagtggaccacgcgatgtcctgcgcggattattttctaaaacgaatcaaggaaacc
actggcttccgattggtgctgcctgcttatcagtgttgcaacgtttgtttctggtacata
cctccgagtatgcgcgaaaaggaagagaatgaagactggtggcacaaattgtacgtgatc
acaactacgataaagaaacgtttgacgttggaaggatctcttttgatcggctacacgcct
ttgccgcagaagaacattggcaatttctttcgcatggtcgtgaactgccaacctccgccc
acagaatcgtccatggattacgttatcagacagatcgaaaaatctgcggccgatttgtag

DBGET integrated database retrieval system