KEGG   Linepithema humile (Argentine ant): 105672537Help
Entry
105672537         CDS       T04898                                 

Definition
(RefSeq) alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu00052  Galactose metabolism
lhu00500  Starch and sucrose metabolism
lhu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105672537
   00500 Starch and sucrose metabolism
    105672537
Enzymes [BR:lhu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105672537
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF3459
Motif
Other DBs
NCBI-GeneID: 105672537
NCBI-ProteinID: XP_012222970
LinkDB All DBs
Position
Unknown
AA seq 574 aa AA seqDB search
MHRTCVLIAALVALTSAAAISPEARGNKNWYKNSLVYQIYPRSYKDSNGDGIGDLNGITS
KLEHIADIGADAIWLSPIYPSPQIDYGYDIANYTDVNEEYGTLHDFDRLVAKAKSLGLKV
LLDFVPNHSSHEHEWFKKSIQGIKPYDEYYVWRDAKIVNGTRQPPNNWLSAFQGSAWEWN
DVRQQYYLHQFAAGQPELNYNSIALQQEIKNVLTFWMNRGVEGFRIDTVNHLFEDPRFLD
EPPTNIPGLPPDDYDTLDHIYTKNQLPSYDLLKTWRKLLDRHSPKADTKMFLTEAYADLN
FTMLYYPAGSTVPFNFMFVSDLNNKSTAADFKRYVDRWLNNMPEGSQYVPNWVVGNHDNH
RVASRYGEKRADQLSMLSTILPGVTVIYNGDEIGMLDRNFTYEETKDPAGCNAGPDRYHL
KSRDPERTPFQWDNTVSGGFSTSSKTWLPVHSNYRTLNLAAQKTAAKSHYKVFKSLTKLK
KKPIVARGSLQTTLVTEKILGVVRRRNKSVVTLLINFADEPVTVDARTWLNIPEELIIYA
PSVDSNLVAGSRADTTHFTVPGSASVVLTTADLV
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgtacgtgcgttctcattgcggcacttgtcgcgctgaccagtgccgcggcgatt
tccccggaagccaggggtaataaaaactggtacaagaacagtctggtatatcagatctac
ccgagaagctacaaagatagcaatggagacggcatcggtgatttgaacggcatcacgagc
aaattggagcacatcgcggacatcggcgccgacgctatctggctgtcgccgatctacccc
agtccgcagatagattacggctacgacatcgccaactacaccgatgtcaatgaagaatac
ggtactctgcacgatttcgacagactcgttgcgaaggcaaagtccctcggactgaaggta
cttctcgattttgtgcccaatcacagctctcacgagcacgaatggttcaagaagagcatt
caggggatcaagccttacgacgagtattacgtttggcgcgacgcgaaaatagtcaacggt
accaggcaaccgccgaacaactggttgagcgccttccaaggctccgcctgggagtggaac
gacgtgaggcagcagtattatctgcatcagttcgccgctggtcagccggaactcaactac
aacagcatcgcgttacaacaagaaataaagaacgtgctgacgttctggatgaatcgcggc
gtggaaggtttccgcattgacaccgtcaatcacttgttcgaggatcctcgcttcctggac
gagccgccaaccaacatacccggattgccgcccgacgactacgatactctggaccacatc
tacacgaagaatcaactcccgagttacgaccttctcaagacctggcgaaaactgttggac
agacactcgccgaaggctgacacaaagatgtttctgaccgaagcttacgcagatttaaat
ttcaccatgttgtactatccggcaggctcaaccgtacccttcaacttcatgttcgtttcc
gacctgaataacaaatccaccgcggccgactttaaacgttacgtagatcgctggttgaat
aacatgccagaaggttcacagtacgttccaaactgggtggtaggcaatcatgataatcat
cgcgtagcttcccgatacggtgagaagcgggcggatcagctttccatgctgtcgaccatt
ttacccggtgtcaccgtgatttacaatggcgacgagatcggcatgctggacagaaatttt
acatatgaggaaactaaagatcccgccggatgcaatgctggacctgacaggtaccatctg
aaatcgagagatccggaaagaacgccttttcaatgggacaacaccgttagcggcggtttc
tctactagcagtaaaacgtggcttccggtgcacagcaattacaggactttaaatttggcg
gcgcaaaagaccgcggcaaagtcccattacaaagtattcaagtccctgacgaaactaaag
aagaagcccattgtcgcgcgaggctccctgcagaccacgttggtcaccgagaaaatctta
ggtgtagtacggcgacgcaacaaatccgtcgtgacacttctgattaacttcgccgacgag
ccggtcaccgtcgacgccaggacttggttgaatattccagaggagttgatcatctatgcg
cccagcgtggacagcaatctggttgcaggatcgcgcgctgacacgactcatttcaccgtg
cccggctcagcctccgttgtactcacaacagcggatttggtttag

DBGET integrated database retrieval system