KEGG   Linepithema humile (Argentine ant): 105673077Help
Entry
105673077         CDS       T04898                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial isoform X1
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu00250  Alanine, aspartate and glutamate metabolism
lhu00280  Valine, leucine and isoleucine degradation
lhu00410  beta-Alanine metabolism
lhu00640  Propanoate metabolism
lhu00650  Butanoate metabolism
lhu01100  Metabolic pathways
Module
lhu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    105673077
   00650 Butanoate metabolism
    105673077
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    105673077
   00280 Valine, leucine and isoleucine degradation
    105673077
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105673077
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lhu01007]
    105673077
Enzymes [BR:lhu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     105673077
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     105673077
Amino acid related enzymes [BR:lhu01007]
 Aminotransferase (transaminase)
  Class III
   105673077
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 105673077
NCBI-ProteinID: XP_012223844
LinkDB All DBs
Position
Unknown
AA seq 497 aa AA seqDB search
MFVNKCHHVLSTRTSTRRLLKGVTTWKRCLTTGSREPEGPVVATEIPGPRSRSLLQELNS
IQQASSVQFFADYEKSSGNYIMDVDGNALLDVYMQISSMPLGYNHPAMLEALADPVNQKI
IANRPALGVFPAKDWPNRLKNVLLEKEVAPPGLSHITTMMCGSCSNENAFKNIFIWYAEK
QRQGAPFTKEEIESCMINEKPGSPHYSIMSFKGAFHGRTLGCLSTTHSKYIHKMDIPAFD
WPIASFPEYKYPLEENVRENQQEDKRCIAEVEELFERYKNEKRMPVAGVIIEPIQAEGGD
NHASSEFFQELQRVTRKHGAALLIDEVQTGGGPTGKMWCHEHFNLSTPPDVMTFSKKMQL
GGYYHLEDFKPKQGYRVFNTWMGDPSKVILLEAILEIIKKENLLDRVTRVGDYMLKNLKD
LQNEHSNTINAVRGRGTFIAFNCASSQLRDAIVKKLLTKGIQAGGCGSQAVRLRPALTFT
ERHADIFFDALRSVLKE
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttaacaagtgccatcacgtgctgagcacgcggacctcaactcggcggctacta
aaaggcgttacaacgtggaaaagatgcttaacaaccggttcgagggaacctgaagggcca
gtggttgcgacggaaatacccggccctcggtcgcgtagtttgctgcaggaattaaattcg
atacaacaagcgtcgtccgtacagtttttcgcagactacgagaaatcttccggtaattac
ataatggacgtcgatgggaatgcactgctggacgtttacatgcaaatctcgtcgatgcct
ctaggctataatcatccggcgatgctggaggcgctcgccgatcccgttaatcaaaaaatt
atagcgaatagaccagcattgggtgtctttcctgcgaaagactggcccaacagattgaag
aatgttctgctcgaaaaagaggtcgccccgcctggattatcgcacatcacgacaatgatg
tgcggctcttgttccaatgagaacgcttttaaaaacatttttatttggtacgctgagaaa
caacggcaaggagcaccgttcaccaaagaagaaatagaatcgtgcatgataaatgagaaa
cccggctcgccgcattattccatcatgtcttttaaaggtgcttttcacggaagaacatta
ggttgtctctcaacaactcacagcaagtacattcataagatggatataccagctttcgac
tggcctattgcctccttcccagagtacaaatatcctttggaggagaacgtgcgagaaaat
caacaggaagataagcgttgcatcgcggaggtggaagagttgtttgaaaggtacaaaaac
gagaaaaggatgccggtggccggtgtgataatcgagcccatacaagcagaaggtggcgac
aatcacgcgtcgtcagaattctttcaggaacttcaacgtgtaacgcgaaagcacggcgct
gcgttacttatcgacgaagtgcagactggtggcgggccgacgggaaaaatgtggtgccac
gagcacttcaatttaagtactccgcccgacgtgatgaccttcagcaagaaaatgcaactg
ggcggttattatcacttggaagatttcaagccaaagcaggggtatcgtgtgttcaatacg
tggatgggcgaccccagcaaggtaatactgctcgaagcaatcctggaaataatcaagaag
gagaatcttttagatagagtcacgcgcgttggcgattacatgttgaaaaatttgaaggat
ttacaaaatgaacattccaatacgatcaacgcagtgcgcggtcgtggaactttcatagcg
tttaattgtgcttcgtctcaattgcgagacgccatcgtcaagaaattgttaactaaaggc
attcaagcaggtggatgcggcagtcaggctgtgcgactcaggcctgcgttgaccttcacg
gagcgtcatgctgatatatttttcgacgcgctccgctctgtgctaaaggaataa

DBGET integrated database retrieval system