KEGG   Linepithema humile (Argentine ant): 105673534Help
Entry
105673534         CDS       T04898                                 

Definition
(RefSeq) alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu00052  Galactose metabolism
lhu00500  Starch and sucrose metabolism
lhu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105673534
   00500 Starch and sucrose metabolism
    105673534
Enzymes [BR:lhu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105673534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase Alpha-amylase_C Malt_amylase_C Glyco_hydro_42C Cyc-maltodext_C
Motif
Other DBs
NCBI-GeneID: 105673534
NCBI-ProteinID: XP_012224669
LinkDB All DBs
Position
Unknown
AA seq 564 aa AA seqDB search
MRVVITLCAILLSSSLGHSETKWWQTMSLYQIYPRSFKDSNGVGDVAIGDLNGIMSKLNH
LVESNIDAFWLSPIYPSPMVDFGYDISNFTGINEDYGTMEDFEKLEKTAHDMSLKIILDF
VPNHSSDQHEWFQKSLQSIAPYTDYYLWHKGKKLPNGTVTVPNNWVSVFGGPAWTWRDER
QAYYFHQFAPEQPDLNFENEDVVHAMKDVLRFWLDKGVDGFRVDAIPHLCEDTRLLDEPL
TGNPNPGDYGYTEKIYTKDQPRTYEMVKEWREVLDEYPGDRIIMMEAYANMTMTMKYYVY
GAHFPFNFGLIANTNKDSTAADFKNLIDEWMLNMLVVKGTANWVAGNHDNSRLVTRYGQE
RAQAITMITLLLPGVGVTYNGEEIGMEDTWISWEDTKDPQGCNAGKEKYEKASRDPCRTP
FQWDDTTSAGFSTNPKTWLPVNKNYKTLNLAAQKTQEKSYYSLYKAVSALRKTPAITKGR
LTTKLLNNDVLAFSRKTAGEKSVYVVVNFANKEETVDLSTLVQAPDRLKVYYASTNAHHL
IGNTIEDIHALKIPASGALIYTSM
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgagggtagtaataacgctctgtgcgatattactatcgtccagtctcggacatagcgaa
acaaaatggtggcaaacaatgtcattatatcaaatttatcccagaagcttcaaggatagc
aacggcgttggagatgtagctataggagatctcaacggtatcatgagcaagctgaaccac
ctcgtcgaatcgaatatcgatgccttttggttgtctccgatctatcctagtcctatggtc
gatttcggctatgatatttccaatttcaccggaatcaacgaagattacggcactatggaa
gatttcgagaagctcgagaagaccgcgcacgacatgtcgctcaaaatcatcttggacttt
gttcctaatcactcctcggaccagcacgaatggttccaaaagagcttgcaaagcatcgcg
ccctacaccgattattatctatggcacaaaggcaagaagctgcctaatggaactgttacg
gtgccaaataattgggtgagcgtgttcggtggaccagcatggacctggcgtgatgaacga
caagcgtattattttcatcaattcgcaccagagcaacccgatctcaacttcgaaaacgag
gacgtggtacacgcgatgaaggacgtcttgagattttggctcgataagggggtggacgga
ttccgagtggacgcgataccccatctgtgtgaggacaccagacttttggacgagccactc
acgggtaatccgaatccaggggactacggttacacggagaagatatacacgaaggaccag
ccgcgtacttacgaaatggtaaaagaatggcgggaagtgctggacgagtatccgggtgat
aggattataatgatggaggcttacgcaaatatgacaatgacgatgaagtattacgtgtac
ggagcacactttcccttcaatttcggcctgatcgctaatacgaataaagactccacagcg
gccgatttcaagaatctaatcgatgaatggatgctaaacatgcttgtcgtgaagggaacc
gctaattgggtggctggcaatcacgataactccagattagtgacccgttacggtcaagag
cgagcgcaagctataacaatgataactttactgcttccgggcgtgggtgttacttacaat
ggtgaagaaatcggtatggaagatacatggatctcgtgggaagacacgaaagatccgcaa
ggttgcaatgccggtaaagaaaaatacgagaaggcgtcccgagacccctgcaggactccg
ttccagtgggacgacaccacttcggctggattctccacgaacccgaagacgtggctaccg
gtcaacaaaaactataagacactcaatttggctgcgcagaagacacaggagaagtcctac
tactctctgtataaagcggtttccgctctgcggaaaacgccggcgattacaaaaggaaga
ttaaccacgaaattattgaacaacgatgttctcgctttctccaggaaaactgcgggggag
aaatcggtttacgtagtagtgaactttgcaaataaagaagaaactgtcgacttgtcgaca
ctcgttcaggcacccgatcgattaaaagtttattacgccagtacaaacgctcatcacctt
atcggaaacaccattgaagatattcacgctttgaaaattcccgcatcaggagctctaata
tacaccagcatgtaa

DBGET integrated database retrieval system