KEGG   Linepithema humile (Argentine ant): 105673691Help
Entry
105673691         CDS       T04898                                 

Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu04013  MAPK signaling pathway - fly
lhu04068  FoxO signaling pathway
lhu04146  Peroxisome
lhu04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    105673691
   04068 FoxO signaling pathway
    105673691
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    105673691
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105673691
Enzymes [BR:lhu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     105673691
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 105673691
NCBI-ProteinID: XP_012224922
LinkDB All DBs
Position
Unknown
AA seq 218 aa AA seqDB search
MFAARRLLVSNTIKDVFARSKHTLPELPYDYKALEPIISAEIMQLHHSKHHATYVNNLNI
AEEKLKEAVVKGDVSTQIALSPAIKFNGGGHLNHSIFWCNLSPNCSDPDATLVKQIEKDF
GSLEELKKRLSETTVAIQGSGWGWLGYDQKAKSLRIATCANQDPLQATTGLVPLFGIDVW
EHAYYLQYKNVRPDYVKAIFDIVNWKDVNARFKSASGC
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcagcaaggcgtcttctagtctccaatacaatcaaggatgtgtttgcaagatca
aagcacacacttccggagctgccttatgattataaggctttggaaccaattatatccgca
gaaatcatgcagcttcatcattccaagcatcacgcaacttatgttaataatctgaatatc
gctgaggagaagttaaaggaggcagttgtaaaaggtgacgtcagtacacagattgctctg
agtccagccatcaagttcaacggtggtggtcatcttaatcattcaatcttctggtgcaat
ctttcacccaattgcagtgatcctgatgctacccttgtgaagcaaatcgaaaaagacttt
ggcagcttggaggaactgaaaaaacgcttatccgagacaaccgtagcgattcagggctct
ggttggggctggcttggatatgatcagaaagcaaagtcgcttagaatagcgacctgcgca
aatcaggatccgctgcaggccacaactggtcttgtgcctcttttcggcattgatgtatgg
gaacatgcctactatttgcaatataaaaacgtacgacccgattatgtgaaagcaatcttt
gacattgttaattggaaggatgtaaacgcgcgctttaaaagtgcctccggctgctaa

DBGET integrated database retrieval system