KEGG   Linepithema humile (Argentine ant): 105673775Help
Entry
105673775         CDS       T04898                                 

Definition
(RefSeq) elongation factor Tu, mitochondrial-like
  KO
K02358  elongation factor Tu
Organism
lhu  Linepithema humile (Argentine ant)
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:lhu03012]
    105673775
   03029 Mitochondrial biogenesis [BR:lhu03029]
    105673775
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lhu04147]
    105673775
Translation factors [BR:lhu03012]
 Eukaryotic Type
  Elongation factors
   105673775
 Prokaryotic Type
   105673775
Mitochondrial biogenesis [BR:lhu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    105673775
Exosome [BR:lhu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105673775
  Exosomal proteins of breast cancer cells
   105673775
  Exosomal proteins of colorectal cancer cells
   105673775
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D2 GTP_EFTU_D3 MMR_HSR1 cobW
Motif
Other DBs
NCBI-GeneID: 105673775
NCBI-ProteinID: XP_012225069
LinkDB All DBs
Position
Unknown
AA seq 472 aa AA seqDB search
MALISTRAIFSPVLRHTLKQIIFTKQLPKCQRRYQLGSRLFLPTVSSQRFYAEKKVFSRD
KPHCNVGTIGHVDHGKTTLTAAITKVLSEKELATAKGYNEIDNAPEEKARGITINVAHIE
YQTENRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGTMPQTREHLLLAKQIGID
HIVVFINKVDAADSEMVELVEMEIRELLSEMGYNGDDVPIVKGSALCALEGKNPEIGAEA
IMKLLEEVDKHIPQPQRELDKPFLLPVENVYSIPGRGTVVTGRLERGKLKKGTECEFIGY
NKVFKSTVTGIEMFHQILEEAHAGDQLGALVRGVKRDDVRRGMIMCKPGTMKAYDNIEAQ
VYMLTKEEGGRKKPIANLIQLQMFCKTWDVAAQCTVVGKDLAMPGEDSKLVLKLIRPMVL
EKGQRFTLRDGSVTLGTGVVTNTMKRLTETERVSLLEGKKATMKKEKQQQKQ
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcatttccacaagagcaatcttcagtcccgttttgaggcatactctcaagcag
attatcttcacgaagcaattaccaaaatgtcaacgtcgttatcaacttggcagtcgtttg
tttcttccaactgttagtagtcagaggttttatgcagaaaagaaggtcttcagccgtgac
aaaccacactgcaatgtgggcactattggtcatgttgatcatggcaaaacaactttgaca
gcagctattaccaaagtattatctgagaaagagttagcaacagccaaaggatacaatgaa
attgacaatgcacctgaggaaaaggctcgtggtattactattaatgtggcacatattgag
taccagacagaaaaccgtcattacggacacacggattgcccaggccatgcagattatatt
aaaaatatgataacgggaacagcacagatggatggcgctatactagttgtagctgccaca
gatggtacaatgccacaaacaagagaacatttgttgctcgctaaacagatcggcattgac
cacattgttgtttttattaataaagttgatgctgctgattcagaaatggtagagttagta
gaaatggaaatacgggagttactttctgaaatgggttacaatggtgacgatgtaccgata
gtgaagggtagtgcactatgcgcgctcgaaggaaagaatccagaaataggtgcagaagct
attatgaaattattggaagaagtggacaaacatattccacaaccacagagagaacttgac
aaaccatttttacttccggtagaaaatgtgtattctattcctggacgaggtaccgtagtc
actggtcgattggaacgcggaaaactgaaaaaaggaacggaatgcgagtttataggttac
aacaaagtttttaaaagtacagtcacgggtatagagatgtttcatcagatattggaggaa
gctcacgccggggatcaactcggtgctttagtaagaggtgtgaagagagatgatgtcaga
agaggcatgataatgtgcaaacccggtacaatgaaggcgtatgataatatagaagcgcaa
gtgtatatgttgacaaaggaagaaggtggcagaaagaaaccgattgcaaatttaatacaa
ctacaaatgttctgcaaaacgtgggacgttgcagcgcaatgcacagtagtggggaaggac
ttggccatgccaggagaggatagcaaattggtgctaaaattgataagaccaatggtgttg
gagaaaggacagcgtttcacattgcgagatggttcggtgaccctaggaaccggcgtagtc
acgaacacaatgaagcgacttacggaaaccgaacgagtatcccttctcgaaggcaagaaa
gcaacgatgaagaaagaaaagcaacaacagaagcagtag

DBGET integrated database retrieval system