KEGG   Linepithema humile (Argentine ant): 105674439Help
Entry
105674439         CDS       T04898                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu00052  Galactose metabolism
lhu00500  Starch and sucrose metabolism
lhu01100  Metabolic pathways
lhu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105674439
   00500 Starch and sucrose metabolism
    105674439
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    105674439
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lhu04147]
    105674439
Enzymes [BR:lhu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105674439
Exosome [BR:lhu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105674439
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110
Motif
Other DBs
NCBI-GeneID: 105674439
NCBI-ProteinID: XP_012226162
LinkDB All DBs
Position
Unknown
AA seq 1022 aa AA seqDB search
MTNIKASGHNARGKSEHHNTSVKDCSNNTKIGNNVIVKLDNGTYKSLAGKDHEEKEANNS
TSFRKRIIIRLLLIAFIFSQFYIGFMLLSFVLLPLYTNTSDYDAEIQIIDVNNDIEKTRY
QHIIMDTSDMHIEQQEYDYKTLSFEDTQCTNVPEILRFDCHPEDGASELSCMNRKCCWNP
PKKDIKTAKRIPLNIPYCYYSGDWSLYGYVNCSQDESNFSGFLSQKRNSVYKNDVPLVKI
EATGIDSSILRVKIYDPLKARYEPPWPIRSNPKPFLPKVTNKKYEFKNDNLRPPAFKVDR
VSDGTTLFNSVGGFIFADQFLQISTLLPTSNIYGIGEHRSSLKLNTNWQSFTLFNKDQPP
TENANLYGSHPFYIVVEESGMAHGVLFLNSNAMDVILQPTPAITFRTIGGIFDIYFFLGP
TPADVVKQYSEIVGKPFMPPYWSLGFHLCRFGYGNLENTKAVWNRTRAAGIPFDTQWNDL
DYMDKNNDFTYNKEKFKDLPKFVEEIHSVGMHYIPLIDAGISAFDDNGSYLPYDEGVKQD
IFIKDGVSYKPFVGKVWNFVSTTWPDFTNPKTMEYYANMMGDMHNNFAYDGAWIDMNEPS
NFYNGNKNGCIHNNLDYPEYIPNVVGGLLATKTLCMNARHYLGFHYDLHNTYGTSQAIAT
NYALRKIRQKRPFIISRSTWVGHGHYAGHWTGDVYSSWHDLKMSIPAILSLNFYQIPMVG
ADICGFDGNTTAALCNRWMQLGAFYPFSRNHNSDDTIEQDPVAMGDLVVRSSKNAFKIRY
RFLPYLYTLFFRAHKFGETVARPLFFEFTNDRQTYDIDTQFLWGSALMINPVLEENIIEI
PVYIPRGLWYDYYSFKSFFSIGKHYTLPAPVDRIPLLIRGGSILPAQKPGVTTTESRKNK
FELLVALDEAGNATGELYWDDGDSIDSLKKNQYLWLSFTANKFSLKNKKIDNGLFDEEVI
LGNVRILGLDQVSKVLLNDKEIKYNYDVFTSSLSITDLQVDMRQPFIFSWMYTNFEYDMQ
YY
NT seq 3069 nt NT seq  +upstreamnt  +downstreamnt
atgactaatataaaagcaagtggacacaatgctcgtggaaaatcagagcatcacaataca
tcggttaaagattgctcaaacaatacaaaaattggtaacaatgtgattgtaaagttagac
aatggaacttataagtcattggcaggaaaagatcatgaagaaaaagaagcaaacaattct
acttcttttagaaagagaataattatacgtttattgctcattgcatttatattttctcaa
ttttatattggttttatgctgttatcttttgttttacttccattatataccaacacaagt
gattatgatgcagaaatacaaataattgacgtaaacaatgatattgaaaagacaagatac
cagcatataataatggatacctcagacatgcacattgaacaacaagaatatgattacaag
acattatcatttgaagatactcaatgcaccaacgttcctgaaatcttgcgttttgattgc
catccggaggacggagcgtctgaactgtcctgtatgaacagaaaatgttgttggaatcct
cctaaaaaagatatcaaaactgcaaaacgtatcccattaaatattccttattgttattat
tctggagattggagtctgtatggatatgttaactgcagtcaggatgaaagcaatttctca
ggttttctcagccaaaagaggaactctgtatacaaaaatgatgtgcctcttgtgaaaata
gaagctacaggcatagatagttccattctgcgtgtgaagatatatgaccccttaaaagca
cgatatgaaccaccatggcctatcagatcaaatcctaagccatttttgcccaaagttacg
aacaaaaaatatgaatttaagaatgataatttaagacctcccgcttttaaggttgataga
gttagtgatggcacaacattattcaattctgtcggtggttttatatttgctgatcagttc
ttacaaataagcacattattaccaacgagtaacatttatggcattggcgagcataggtca
agcttaaaattgaatactaactggcaatcgtttactttgttcaataaagatcagccacca
acagaaaatgcgaatttgtacggatctcatccgttttatattgttgtggaggagtctgga
atggctcatggagttttattcttaaatagcaacgccatggatgtaatattgcaacctaca
ccagctataacgttcaggaccatcggcggtattttcgatatttatttctttttggggccc
actccagcggacgttgtgaaacagtattccgagatcgtgggcaaaccgtttatgccacct
tattggtcactcggttttcatttatgcagatttggatatggaaacttggaaaatacgaaa
gcagtatggaacagaacgagagcagccggaattccatttgatactcaatggaatgatttg
gattatatggacaaaaacaatgattttacgtataataaggagaaattcaaagatttgcct
aagtttgtagaagaaattcactcggtgggaatgcattatattccgttaattgatgctggc
atatccgctttcgacgacaatggctcttacttgccgtacgatgaaggggtaaagcaggac
atattcataaaagacggcgtatcgtataaacctttcgttggcaaagtttggaattttgtt
tccaccacatggcctgatttcacgaatcctaaaacgatggagtactacgcaaatatgatg
ggcgatatgcacaataattttgcatacgacggtgcatggatcgatatgaatgaaccgtcc
aacttctacaatggtaacaagaatggctgtatacacaataatctggattatcccgaatat
atacccaatgtcgtcggtggtttgctcgctacgaaaactctgtgcatgaatgcaagacat
tacttgggctttcattacgatcttcacaatacttacggaacgagccaagcgattgccacg
aattatgccctgaggaagatcagacagaaaaggccattcataatatcgcggtcaacgtgg
gtaggacacggtcattacgcgggccactggacaggcgacgtttactcatcatggcatgat
ctgaagatgagcattccggcaattttgtcactgaatttctatcaaatcccaatggtgggc
gctgacatttgcggttttgacggcaacacaaccgctgcgttgtgtaaccgttggatgcaa
ctcggtgccttttatccattttcgcgaaatcacaattccgacgacacaattgagcaggat
ccagtcgctatgggtgatttagtcgtgcggtcgtcaaaaaatgctttcaaaatacgttat
cgatttttaccatatttatataccttattcttcagagcacataaattcggagaaacagta
gcacgcccattattcttcgagtttaccaatgaccgacagacttacgatattgatacgcaa
tttctctggggaagcgcgcttatgatcaatccagttctcgaagaaaatataattgagata
cccgtttatataccacgtggcttgtggtacgattattatagttttaaatctttcttctcc
atcggcaaacattacacattaccagcgccggtggacagaataccattattaattcgtgga
ggatcgattcttccggcacagaaaccaggtgtaactacaacggagagcagaaagaataaa
tttgaattattagtagcactggacgaggctggaaatgccacaggagaattgtactgggac
gacggtgacagtatagattctttaaaaaagaaccaatatttgtggctgtctttcactgca
aacaaattcagtttgaaaaacaagaaaatagataacggcctttttgacgaggaggtaatt
ctggggaatgttcggattttgggattagaccaagtctccaaagtattattaaatgacaag
gaaataaaatataactacgacgttttcacatcgagcctaagtatcactgacttgcaagtg
gacatgagacagccgttcatattttcttggatgtatacaaactttgagtatgatatgcaa
tattattaa

DBGET integrated database retrieval system