KEGG   Linepithema humile (Argentine ant): 105674932Help
Entry
105674932         CDS       T04898                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: superoxide dismutase [Cu-Zn]-like
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu04146  Peroxisome
lhu04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    105674932
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105674932
Enzymes [BR:lhu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     105674932
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-GeneID: 105674932
NCBI-ProteinID: XP_012227043
LinkDB All DBs
Position
Unknown
AA seq 152 aa AA seqDB search
MVKAVCVLQGEPVKGTVYFEQADGSNAVKVTGEVSGLQKGLHGFHVHEFGDNTNGCTSAG
AHFNPLGKEHGGPSHSVRHVGDLGNVEASADGVAKVNLXDSQIQLTGAHSVIGRTLVVHA
DPDDLGQGGHELSKTTGNAGARLACGVIGVTK
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaggcagtctgtgtccttcagggcgagcccgttaagggaacggtgtactttgag
caagcggatggttcgaatgcagtgaaagtgactggagaggtatctggcttgcaaaagggc
ttgcacggtttccacgttcatgaatttggtgataataccaatggttgcacaagcgctggt
gctcacttcaatccactgggaaaagagcacggtggtccaagccattctgtgcgtcacgtt
ggtgatttaggaaacgtggaggctagcgctgatggtgtggctaaggtcaatctcnntgac
tctcagatccaacttaccggagcacacagtgtcattggacgaactcttgtggttcatgct
gatcctgatgatcttggccagggtggccacgagctgtcaaagacaaccggtaacgctggc
gctcgtctcgcttgcggtgtcattggtgtcacgaagtaa

DBGET integrated database retrieval system