KEGG   Linepithema humile (Argentine ant): 105675674Help
Entry
105675674         CDS       T04898                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu00020  Citrate cycle (TCA cycle)
lhu00190  Oxidative phosphorylation
lhu01100  Metabolic pathways
lhu01200  Carbon metabolism
Module
lhu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lhu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lhu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    105675674
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    105675674
Enzymes [BR:lhu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     105675674
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 HI0933_like FAD_binding_3 GIDA NAD_binding_8 Lycopene_cycl FAD_oxidored
Motif
Other DBs
NCBI-GeneID: 105675674
NCBI-ProteinID: XP_012228381
LinkDB All DBs
Position
Unknown
AA seq 623 aa AA seqDB search
MECRKYFEINPENYPLIDHCYDVVIVGAGGAGLRAAFGLGKKGYRVAVISKLFPTRSHTV
AAQGGINAAITDEKDDNWLYHMYDTVKGSDWLGDQDAIHFLTREAPRAIYELENYGCPFS
RTENGKIYQRAFGGQSLKFGKGGQARRTCAVADRTGHAVLHTLYGQSLRYDVHYFVEYFA
LDLLMHGRCCKGILAYELETGLLHRFRAHHTMMATGGAGRCYFSCTAAHACTGDGMAIAC
RAGLPLQDMEFIQFHPTGIYGSGILITEGSRGEGGRLVNSKGEFFMDKYAPKAKDLASRD
VVSRAMTIEILEGRGVGENKDHIYLQLNHLPVELIRERLPGISHLAWVFAGVDVTKQPIP
VIPTMHYNMGGIPTNWRAQVLTRENEDDRPIEGLWAAGETACASVHGANRLGANSLLEIV
VFGKAIADQIDCITRPGERHEDLSPDISEQSICRFDATRYAKGCVPVAELREEMQRTMHK
YCSVFRTCDILQRGCREITRLYTCDLPDLCVQDQSLIWNTELVEALELQNMMLCCMHTVY
GAENRKESRGSHAREDFKDRIDEYDYTKPLEGQKKRPYTEHWRKHTLTWAQDDGLICISY
RPVIDTTLDESEAQHVPPAVRAY
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atggaatgtagaaagtatttcgagattaatcctgagaattatcctctgatagatcactgc
tatgacgtagtaatagtgggagcgggaggcgcaggattaagagcggcttttggtctcggt
aaaaaaggatatcgagtggcagtgatatcaaagctctttccgaccaggtcgcacaccgtg
gcagcccagggtggtataaatgctgctatcaccgacgaaaaagacgacaattggctctat
cacatgtatgacactgtgaaaggatccgattggctgggtgatcaggacgctatacatttt
ctcacgagagaagcgcctcgagcgatttacgagcttgaaaattatggttgccctttcagt
cgtacggaaaacggtaagatctatcagcgagctttcggcggtcagtccttgaaatttggc
aagggcggacaagctcgtcgaacttgcgccgtcgctgatcgaaccggccacgcagtgctt
catactctttatggacaaagtcttcgctacgatgtgcactatttcgtcgaatatttcgct
ctcgatctgctcatgcacggccgatgctgcaagggaatcctggcatatgaattagaaacc
ggtcttctgcatcgattccgagcccatcatacaatgatggcaacaggcggtgccggaaga
tgttacttttcttgcaccgcggctcatgcctgcaccggcgatggcatggcaatcgcctgt
cgagcgggattgccgcttcaggacatggaatttattcaatttcatccgactggtatttac
ggcagtggtatattaataactgaaggaagcagaggagaaggtggcaggctcgtcaactcc
aaaggagaattctttatggataagtacgcgcccaaagccaaggatctagcttcgcgcgat
gtcgtgtcgagagcaatgaccatcgaaatattggagggaagaggcgtcggggagaataaa
gatcacatctatttgcaattgaatcacctgccggtcgaactgatacgcgagaggctaccc
ggaatctcgcatcttgcctgggtattcgccggagtggacgtgactaagcaacctatcccc
gtgatacccacgatgcattacaatatgggtggtatacccacaaattggcgagcgcaagtg
ttaacacgagaaaatgaggatgacagaccgattgaaggtctctgggcagccggcgagacc
gcatgtgcgtcggttcacggtgctaatcgtttgggtgctaatagtctcctggaaattgtg
gtcttcggcaaagccatcgccgatcaaatcgactgcattaccagacctggtgaacgtcac
gaagatctgtcgccagacattagcgagcagtcgatttgtcgttttgatgcgactcgttat
gcgaaaggttgcgttcctgtggccgagctacgcgaagaaatgcaacgcacaatgcacaag
tattgctcggtattcaggacttgcgacattctgcaacgcggatgcagggagataactcgt
ctctacacttgtgacctaccagacttatgtgtacaagatcaatccctcatttggaacaca
gagctcgtcgaggccttggaattacaaaatatgatgctctgttgcatgcatactgtgtac
ggggccgaaaatcgaaaggagtcaagaggttcccacgccagagaagacttcaaggataga
atcgacgagtatgattacacaaaaccgctcgagggacaaaagaaacgaccttacacggaa
cattggcgtaagcatacacttacgtgggctcaggatgatgggttgatatgcatctcttat
cgacctgttatcgatacgacactagatgaaagcgaagctcaacacgtgccgcctgcagtt
cgcgcatattga

DBGET integrated database retrieval system