KEGG   Linepithema humile (Argentine ant): 105676415Help
Entry
105676415         CDS       T04898                                 

Definition
(RefSeq) pyrimidodiazepine synthase-like
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu00480  Glutathione metabolism
lhu00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    105676415
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    105676415
Enzymes [BR:lhu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     105676415
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_C_3 GST_N_4 GST_C
Motif
Other DBs
NCBI-GeneID: 105676415
NCBI-ProteinID: XP_012229689
LinkDB All DBs
Position
Unknown
AA seq 241 aa AA seqDB search
MTTKHLSAGSVPPPLVPGKIRLYSMRFCPYAQRIHLVLDAKRIPYDTVYVNLTVKPDWLI
EKNPSNKVPCIELENGDILYESLIIADYLDDAYPEDKLYPSNSLAKAKDKLLIERFNAVI
ATMHKGFVQETFDQEVYSEALANLEIFDRELAKKGTPFFGGSKPGMVDLMIWPWCERADV
IRILRGEQFVIPRERFLRLLEWKTAMKEDPAVRGSFLDAEVHAKYIQSRLAGIPQYDLIV
N
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgaagcatttgagtgccggatcggtgcctccaccccttgtacctggaaaaata
cgtttgtacagtatgcgtttttgtccatacgcgcaaaggatacaccttgtattggatgcc
aagcgaattccatatgatacagtatatgtgaatctaacagttaaaccagactggttaata
gaaaagaacccatcaaataaagttccttgtattgaattagaaaatggagatatactatat
gaaagcctaatcattgctgattatctggacgatgcctatcctgaagataaactttatcca
agtaattctttagcaaaagctaaagataagttattgattgagagatttaatgcagtgata
gcaactatgcacaaaggatttgttcaagaaacattcgaccaagaggtatacagtgaggcg
ctagccaatttagaaatctttgatcgagagttggccaagaaaggaactcccttttttgga
ggaagcaaacctggcatggtggatctaatgatatggccatggtgcgaaagagcagatgta
ataagaattttacggggggagcagtttgtcatacctcgagaacgttttctgcgactgctt
gaatggaaaactgctatgaaagaagatccggcagtacgtggcagcttcttggatgctgaa
gtacacgccaagtatattcagagtcgcctagccggaatacctcagtacgacctaatagtt
aattaa

DBGET integrated database retrieval system