KEGG   Linepithema humile (Argentine ant): 105677528
Entry
105677528         CDS       T04898                                 

Definition
(RefSeq) uncharacterized protein LOC105677528
  KO
K16679  wengen
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu04013  MAPK signaling pathway - fly
lhu04214  Apoptosis - fly
lhu04215  Apoptosis - multiple species
lhu04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    105677528
   04391 Hippo signaling pathway - fly
    105677528
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    105677528
   04215 Apoptosis - multiple species
    105677528
SSDB
Motif
Pfam: TNFR_c6 Trp_oprn_chp CD225
Other DBs
NCBI-GeneID: 105677528
NCBI-ProteinID: XP_012231640
LinkDB
Position
Unknown
AA seq 338 aa
MPRESCPGLLLTLVSIFVGLCESSAAGGATSGAQQQQPQQTPPQPQQQQQQHPVCKPGLE
FWSADRASCWPCTRCAPEFTLSPCAIHKDAICGPLSALELDWSFLSSTVRKKPASEAGSQ
HRLDETVTSKVFWRLPEVRPTEEAGNLVDLGRQDDDNEEEPVSASQESKTGYDPRERRKL
VAEDSLSWDWQTGALVLAVCACIVFFLVAGCSALVYARQWRRMKRNFEPAGLEEISARLN
LMVKAELAELVAGAPMNPGDPETRCQYLEKLLDRKRETPAVTAAAATVAAAAWPEAAAGN
LYIEEGGTTTPRSKRSQIARIQRNIETILSHKTNQGAD
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgccgagggaatcctgtcccggattgctgttgaccctggtgtcgatattcgtcggcctg
tgcgagtcctccgccgccggcggcgcgacatccggcgcccagcagcagcaaccacagcag
acaccgccgcagccgcagcagcaacagcagcaacatccggtctgcaagcccggcctggag
ttctggtccgccgatcgcgcctcttgctggccgtgcactcgatgcgcccccgaattcact
ttgagcccgtgcgcgatacacaaggacgcgatctgcggcccgctgtcggccctcgaactc
gactggtccttcctgtcgtcgacggtcaggaagaaaccggcgtcggaggctggtagtcag
catcgtctcgacgagaccgtcacctcgaaggtgttctggcgcttgcccgaagtgcggccc
accgaggaagccggtaatctcgtcgacctcggtcggcaggacgatgacaatgaagaggag
ccggtctccgcctcgcaggaatcaaagacgggatacgatcctcgagagaggagaaaactg
gtcgccgaggacagcctgtcgtgggattggcagaccggcgccctagtcctcgccgtatgc
gcctgcattgtgttcttcctggtggcgggatgctcggccctcgtctacgcgaggcagtgg
cggcgaatgaagaggaactttgaaccagcgggtctcgaggagatctcggcaagattgaat
ctgatggtgaaggcggaactggccgagctcgtcgcaggagcaccgatgaatccaggtgat
cccgagaccagatgtcagtatcttgaaaagcttttagaccggaaacgggagactccggcg
gtgacggcggcggcagcgacggttgcggcggctgcctggccggaggcagccgccggcaac
ttatacatcgaggagggaggcacgacgacgccgaggagtaagcggtcgcaaatcgcgcgg
attcagcgcaacatcgagaccattctcagtcacaagacaaatcagggcgccgattga

DBGET integrated database retrieval system