KEGG   Linepithema humile (Argentine ant): 105677666Help
Entry
105677666         CDS       T04898                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
lhu  Linepithema humile (Argentine ant)
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lhu01002]
    105677666
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lhu04147]
    105677666
   04090 CD molecules [BR:lhu04090]
    105677666
Enzymes [BR:lhu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     105677666
Peptidases [BR:lhu01002]
 Metallo Peptidases
  Family M2
   105677666
Exosome [BR:lhu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105677666
CD molecules [BR:lhu04090]
 Proteins
  105677666
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 105677666
NCBI-ProteinID: XP_012231848
LinkDB All DBs
Position
Unknown
AA seq 637 aa AA seqDB search
MLRLILVAAIVALAAAQPMDPVDPTQDPQVAAQDLTQRAKDMLKRIDKLYAEWNHKQSIA
GWNYASNLTDENLAEKLNVSAAAARVTKQVAQEVNDFPWRELQDDNLKRQFQKLSVLGTA
ALPEESYKEFETTISEMENIYSTAKICDYKNKTKCDLALEPEITEILMRSRDPEELKHIW
VEWRKASGEKVKSLYPKYVELANTAARLNNFSDYAAYWMKDYEADDFPDQIESLWQQLKP
LYLQLHAYVRRELRKKYGENVVSKNGPIPAHLLGNAWAQTWSNIADFTTPFPGKKLPDVS
AALVDQGYNATSMFRLAENFFTSINLTAMPDTFWEKSILEKQKGVDMICHASAWEFYDGK
DFRIKQCTRVNMEDLLTAHHEMGHIEYYLQYKGQPAVFKEGANPGFHEAVGDVISLSAST
PSHLKKIGLLKDDATDQEAVLNHLYSKSLDKIAFLPFAYMMDRWRWNVFQGKVTTDNYNC
NWWSLAEEYQGIEPPVDRSEDDFDPGAKYHIIADVEYIRYYVSFVIQFQFHKALCTEAKQ
YDPKNPSANPLHQCDIYDNKDAGNLLKSMLELGSSKPWQDAMEKIAGVRQMDSAGLLEYF
KPLTDWLTEENKKTNEYIGWKSTTKQCVQTREELVNV
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcctaatcttggtagcagcaatcgtagctttggcagcagcccagccaatggat
ccggtagaccccacccaagatccgcaggttgccgcacaagacctcacgcagagagccaag
gatatgttgaaacgcatagacaaactgtacgcggaatggaatcacaaacaaagcatcgcc
ggatggaactatgcgtcgaatttgacggatgaaaatctggcggagaagctgaacgtatcc
gcggcggcagcgcgcgttacaaagcaggtcgctcaggaagtgaacgacttcccttggagg
gaattacaagatgacaatctaaagagacagttccagaagctctccgtgctcggaaccgcc
gcgcttccagaagaaagttacaaggagtttgagacgacgatcagcgagatggagaacatc
tacagcacggcaaagatctgcgactacaagaacaagaccaagtgcgatctcgcgctcgag
ccggaaatcaccgagatcctgatgcgcagccgggatcccgaggagctgaagcacatctgg
gtggagtggaggaaggcgtcgggcgagaaggtcaaatccttgtatccgaagtacgtcgag
ctggccaacacagcggcgagactcaacaatttctccgattacgccgcgtactggatgaaa
gattacgaggctgacgacttccccgatcagatcgagtccctctggcagcaactgaagccg
ctgtacctgcagctgcacgcttacgtgcgtcgcgagctcagaaagaagtatggcgagaac
gtcgtctccaagaacggcccgatcccggcgcatttgctgggcaacgcctgggctcagact
tggtcgaacatcgcggacttcaccacgccgttcccggggaaaaagttgccggacgtcagc
gctgctctggtcgaccaaggttacaacgcgacaagcatgttccgcctcgccgagaacttc
ttcacgtcgatcaacctgaccgccatgccggacactttctgggaaaagtcaatcctggag
aagcagaagggcgtggacatgatctgccacgcgagcgcgtgggagttctacgacggcaag
gacttcaggatcaagcagtgcacgcgcgtcaacatggaggacctgctgacggcgcaccac
gagatgggccacatcgagtattatttgcagtacaagggtcagcccgctgtcttcaaggaa
ggcgcgaatcccggcttccacgaggcagtcggcgacgtcatctccctcagcgcgtccacg
cccagccacctcaagaagatcggtctgctgaaggacgatgcaaccgatcaggaggcggtg
ctgaatcacctctactcgaagagtctcgacaagattgccttcctgccgttcgcctacatg
atggatcgctggcgctggaacgtgttccagggaaaagttacgaccgacaattacaactgc
aactggtggtcgctggcggaggaataccaaggcatcgaaccgccggtggacaggtcggag
gacgacttcgaccccggcgcgaagtaccacataatcgcggatgtggagtacataagatac
tacgtgagcttcgtgatacaattccagttccacaaagcactgtgcaccgaggcgaaacag
tacgatccgaagaatccaagcgccaatccactgcatcagtgtgatatttacgataataaa
gatgcaggaaatttgctgaaatctatgctggagctgggttcttcgaaaccctggcaagat
gcgatggagaagatcgcaggcgtgcgacagatggactctgccgggctgctggagtacttc
aagcctctgaccgattggctgaccgaagaaaacaagaagactaatgaatacatcggttgg
aagtccaccacaaaacaatgcgtacagacgagagaagaacttgtaaatgtatag

DBGET integrated database retrieval system