KEGG   Linepithema humile (Argentine ant): 105678451
Entry
105678451         CDS       T04898                                 

Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu00230  Purine metabolism
lhu01100  Metabolic pathways
lhu04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    105678451
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105678451
Enzymes [BR:lhu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     105678451
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF2258
Other DBs
NCBI-GeneID: 105678451
NCBI-ProteinID: XP_012233232
LinkDB
Position
Unknown
AA seq 1013 aa
MSQRGRRATTTTQTTMNEDFYLTCGRPSNLLRTSFSSAGLEKLYRASSLQQRRGGLTCFL
MSAILYGIYAISVPGVELPTRAVTAVFLSLNVCLLVWAERGTKARNSLWSVVPCVVGQLW
IVHLPAQLFLQSAKVTPRDGLGWMLLLLYLLFASLPLKLCCCVSLALGSVLVYFVAVIGL
SSTTFEELKMQPVDAARVLILTVTLFAGAAILGACSYCLAEFQQRRAFLETRQSLEVQLM
IEEQSAEQERLLLSVLPEHVAVKMRQDLGASLDTQFKKIYMSRHENVSILYADIVGFTAI
SSTYSASELVKILNELFARFDQLSERYEQMRIKILGDCYYCISGAPVERPDHAVLCVHMG
LSMVEAIKYVQQTTNSPVDMRVGIHTGAVLAGVLGQRQWQFDVYSKDVELANKMESSGRA
GRVHISNSTLRFLNGEFEVEPAHGEDREEALQKAGLVTYFIVRALKPFKPAVTKSLASLA
DAENSQRTMESAQDKGDNSREDSEEFQQRLRKKLDSRGGGTDLKGHASWLTLRFKDSTVE
TDFHSIMEAFSPLSLLGGPLVTLCAAPVWKLLPWGPFTWGGAGVVTLFGIVLAGATCLGS
AVRATWLRSTLAVLMTFSLIIFLLLDMCNCAIVEEADPPKNASLSWSPRCPYPSYYSYIG
VLALVAISMPTYLCYLTKACLMYFLAGAQSCINVLYLAPILDREDVASYPSGVVPFPLRY
SLSATLFVVATALVIVARYAEKARRMLYLRGREVMAQRERAADMKRRNGVLIYNILPPHV
AAYFLSHARHYDDLYSQSYAEVGVLFASMPNFADFYSEESINNQGLECLRFLNEVISDFD
AILDQEKFKGIIKIKTIGSTYMASSGITETTQSEDGPRWGHLVTLVEFALELKKALSSIN
EQSFNHFVLKMGINHGPVTAGVIGARKPHYDIWGNTVNVASRMESTGKVGCIQVTDETRK
ILEPFGFGFEQRGLVFVKGKGQLLTHYLVSKDGVFLDLDSDLPVEPTHPIIYQ
NT seq 3042 nt   +upstreamnt  +downstreamnt
atgtcacagcgcggacgacgcgcgaccacaacgacgcagactacgatgaacgaggatttc
tacctgacttgtggcaggccgtcgaacctgctgcggacgagcttcagcagcgctggcctt
gagaagctctatcgcgcctcgtcgctgcagcagcgtcgcggcggtctcacgtgcttcctt
atgtcggcgattctctacggcatctacgcgatctcggtgccgggcgtcgagctgccgacc
cgcgccgtcaccgcggtcttcctcagcctgaacgtctgtctgctggtctgggccgagcgc
ggcaccaaggcgcgcaactcgctctggtcggtggtgccgtgcgtggtcggccagctgtgg
atcgtccacctgcccgcacagctgttcctccagtcagccaaggtcacgccgcgggacggc
ctaggctggatgctgttgctgctctacctgctgttcgccagtctgccgctcaagctgtgc
tgctgcgtgtccctcgcgctcggcagcgtcctcgtgtacttcgtcgctgtgatcggcctg
tccagcacgacgttcgaggagctgaagatgcagcccgtggacgcggcccgtgttctgatc
ctgacggtgacactttttgcgggcgccgctatcctgggcgcgtgcagctactgcctagcg
gagttccagcaacgccgggcgttcctggaaaccaggcagagcttggaggtgcagctgatg
atcgaggaacagagcgcggagcaggagcggctactgctcagcgtcctgccggaacacgtc
gcggtcaagatgcggcaggatctcggcgcgtctctcgatacgcagttcaagaagatttac
atgtccaggcatgaaaacgtgtcgatactttacgccgacatagttggcttcaccgcgatc
tcgtcgacttacagtgccagcgagctggtcaaaatactcaacgagctcttcgcacgattc
gatcaactcagtgaacgatacgagcaaatgcgcatcaagatcttgggcgactgttactac
tgcataagtggtgcgcccgtcgaaaggccagaccacgcagttctctgcgtgcacatgggg
ctgtccatggtggaggcgatcaagtacgtgcaacaaacgaccaacagccccgtcgacatg
agggtgggcatccacacgggcgcggtgctcgcaggagttctcggccaacggcaatggcag
ttcgacgtttacagcaaggacgtcgagctggcgaacaagatggagagcagcggaagagcc
gggagggtacacatctcgaattcgacgctgcgcttcctaaatggcgaattcgaggtcgag
ccggcgcacggagaggatcgggaagaggcgctccaaaaagctggccttgtcacttacttt
atagtaagggccttgaaaccatttaagccggcggtgacgaagagcctcgcgtcgttggcg
gacgcggagaactcacaaaggacgatggagagtgcgcaagacaagggggacaatagcagg
gaagattccgaggaatttcagcaacgtctgaggaagaaacttgacagtagaggtggtggt
accgacctaaaaggtcacgcctcctggttgaccttacgattcaaggattcgaccgtagag
acggacttccacagcatcatggaagccttctcgcctctgtcgctcctcggcggacccctg
gtgacgttgtgcgccgctccggtctggaagctactaccttggggaccgttcacgtggggt
ggcgccggggtggtcaccctcttcggcatcgtgttagctggcgccacttgcctgggcagc
gccgtcagggcgacgtggctcagaagcacgctcgcagtcctaatgacattctccctcata
atcttcctgctgttagacatgtgcaactgcgcgatcgttgaggaagccgacccgccgaag
aacgcctcgctcagctggtccccgcgctgcccgtatccttcctattactcgtacatcggc
gtcctcgcgctggtcgctatttcgatgccgacgtacctctgttacctgaccaaagcgtgc
ctgatgtacttcctcgccggcgcgcagtcctgcatcaacgttctgtatctcgcgccgatc
ctcgaccgggaggacgtggcgtcgtatccgtctggagtcgtgccctttccgttgagatac
tctttgtcagctacgctatttgtcgtcgcgaccgcgctagttatcgtggcgagatacgct
gagaaggcgaggagaatgttgtatctgcgaggacgagaagtaatggcgcagagagaacga
gcggcggatatgaagcggcgaaacggcgtgctcatatacaacatcctgccgccccacgtt
gccgcgtacttcctgtcgcacgcgaggcactacgacgacctctacagtcagagctatgcc
gaggtgggcgtgttattcgccagtatgccgaactttgcggacttctacagcgaggaaagc
atcaacaatcaaggcctcgagtgcctgaggttcctgaatgaggtcatctccgatttcgat
gccatccttgatcaggagaaattcaagggcattatcaagatcaagacgatagggtcgacc
tatatggcctcatcgggcataaccgagacaacccagtcggaggacggtcctcggtggggc
cacctcgtcactctcgtagaatttgctctggagctgaagaaagctctgtcgagcatcaat
gaacagagcttcaatcattttgttctgaagatgggcatcaatcatggaccggtgaccgcc
ggcgtcatcggagcgcggaaacctcattatgacatctggggcaacactgtcaatgtcgcg
tcgaggatggagagcacggggaaagtcggttgcattcaggttaccgacgagacccggaag
atattggagccgtttggtttcggctttgagcagcgcggtcttgtcttcgtgaagggcaag
ggacagctcttgacgcactatcttgtgtccaaggacggcgtcttcctggatctcgatagc
gatctgccggtcgaacccacccatcccataatctaccaataa

DBGET integrated database retrieval system