KEGG   Linepithema humile (Argentine ant): 105678789Help
Entry
105678789         CDS       T04898                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic-like isoform X1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu04146  Peroxisome
lhu04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    105678789
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105678789
Enzymes [BR:lhu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     105678789
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu Cytomega_TRL10
Motif
Other DBs
NCBI-GeneID: 105678789
NCBI-ProteinID: XP_012233857
LinkDB All DBs
Position
Unknown
AA seq 228 aa AA seqDB search
MFRCAIPFYCTNKANHHLTYTMSRMVILLLAAVTAVTAEELVAVVHLTPNDASTHNVKGD
LKIVQSVPNGPVTISGKITGLTEGLHGFHVHEKGDLSEGCKSAGAHFNPENVTHGAPEDN
VRHVGDLGNIQANSDGEATINITDTIISLSGSNSILGRAIVVHSGEDDLGKGNSTLSSTT
GNAGDRWACGVIGIQSPTEGWNSGSFTAPNVSFLVIFFVVIVYQHLKF
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgttccgttgcgcaattccattttattgtacgaacaaggcaaatcatcaccttacatat
acgatgagtcgaatggtcatactactattggcagctgtaactgccgttacagccgaggag
ttggtggcggtcgttcatctaacgccaaatgacgctagtacgcataatgtcaaaggtgat
ttgaagatcgttcagtccgtcccgaacggacctgttactatcagcggtaagattaccgga
ctcacggaggggcttcatggtttccacgtgcacgagaaaggagatttgagtgagggttgt
aaatctgcgggagcgcacttcaatcctgaaaacgtcactcatggcgcaccggaagataat
gttagacacgtcggcgatctgggaaatattcaagccaattctgacggagaagccacaata
aatatcaccgacaccatcatctcgctgagcggatccaacagtattcttggacgagccata
gttgtccattctggcgaagacgatcttggcaagggcaacagcactctttcctcgacaact
ggaaacgccggagaccgttgggcctgcggtgtcatcggcatccagtcgccgacagagggt
tggaactccggttcgtttaccgcaccaaatgtatcattcctcgtgatatttttcgtcgtt
atcgtttatcaacatctcaagttctaa

DBGET integrated database retrieval system