KEGG   Linepithema humile (Argentine ant): 105679484Help
Entry
105679484         CDS       T04898                                 

Definition
(RefSeq) sorbitol dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu00040  Pentose and glucuronate interconversions
lhu00051  Fructose and mannose metabolism
lhu01100  Metabolic pathways
Module
lhu_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    105679484
   00051 Fructose and mannose metabolism
    105679484
Enzymes [BR:lhu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     105679484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 UDPG_MGDP_dh_N TrkA_N Pyr_redox_3 2-Hacid_dh_C FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 105679484
NCBI-ProteinID: XP_012234966
LinkDB All DBs
Position
Unknown
AA seq 350 aa AA seqDB search
MAKDNLTAILYGINDLRLENTNIEEPGDDEVLLEMGCVGICGSDVHYLVNGRIGDFIVKK
PMIIGHESSGTVAKLGKNVKNLEVGDRVAIEPGVPCRTCTFCKEGRYNLCKDVVFCATPP
SHGSLRRYYKHAADFCFKLPDHVSLEEGALLEPLSVGVHACKRGEIGIDSKVLILGAGPI
GLVTLLVVKAMGANKVVITDIVESRLKMAKKLGADDTYLVQKDRSEKDTIADIHAIFGDE
PNRTIDASGAQASIRLAILATKSGGVVVLVGNTAPEVQIPLINALIREVDIRGIFRYVND
YDDALNLVASGKIDVKPLITHNYKIEESKEAFETSRTGAGGAIKVMIHCK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggacaatctcaccgctatactatacggcatcaacgatttacgtctggagaac
actaacatcgaggaaccaggagacgatgaagtgcttctggaaatgggatgcgtaggaatc
tgcggatcagatgtccattatctcgtaaatggtaggatcggcgactttatagtgaagaaa
cccatgatcattggtcatgagtcttccggtactgtcgctaaacttgggaaaaatgttaag
aatttggaggtcggtgatcgcgttgccatcgaacccggtgttccctgcaggacttgcacg
ttttgtaaagagggacgttacaacttgtgcaaggatgtagtgttttgtgctactccacct
tcgcatggcagcctaagacgttattacaaacacgcagctgatttttgctttaagttacct
gatcacgtaagcttagaggaaggagcacttttagagccgttgtcagtaggagtgcatgct
tgcaaacgaggcgaaatcggaattgattctaaagtattaattctgggggctggtcccatc
ggtctagtgacgttgttagtagtcaaagccatgggcgcaaacaaagtggttatcacggat
attgtagaaagtagactgaaaatggcaaagaaactcggtgctgatgatacgtatctggta
caaaaggatagatcggagaaggatacaatagctgatattcacgcaatttttggggatgaa
ccaaacaggacaatagatgcttctggtgcacaagcatcgattcgtctggcaattcttgca
accaaatctggtggagtcgtggtattggtgggaaacactgctccagaagtacaaattcca
ctaattaacgcactaattagggaagttgatatcagaggtatcttccgatatgtaaatgac
tatgacgatgcattgaatcttgttgcatctggcaagatagatgtgaagccattgatcact
cataactacaaaatagaggaatccaaggaggcctttgagaccagcagaactggagcaggt
ggagctattaaagttatgattcactgtaaataa

DBGET integrated database retrieval system