KEGG   Lactobacillus helveticus CNRZ32: lhe_1324Help
Entry
lhe_1324          CDS       T02744                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lhv  Lactobacillus helveticus CNRZ32
Brite
KEGG Orthology (KO) [BR:lhv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lhv01001]
    lhe_1324
Enzymes [BR:lhv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     lhe_1324
Protein kinases [BR:lhv01001]
 Serine/threonine kinases: Other
  Bacterial family
   lhe_1324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like RIO1 Haspin_kinase Seadorna_VP7 Kdo DUF3899 Synaptobrevin
Motif
Other DBs
NCBI-ProteinID: AGQ23799
LinkDB All DBs
Position
complement(1539403..1541418)
Genome map
AA seq 671 aa AA seqDB search
MIDKGYLLGERYRIIDTLGEGGMANVYLAEDIILQRKVAVKILRLDLQNEPQTQARFKRE
ALATSELSHPNIVSVLDVGTDHGLHYMVMEYVDGPDLKEYIHQNAPLDLHEVIRIMDKIL
SAVALAHKHNVIHRDLKPQNILMDKRGNIKIADFGIAVALNQSSVTQTNSVMGSVHYMSP
EQTRGGLVTKQSDIYSLGIILYELITGTVPFNGDTPVSIALKHAQEPIPSIRKKDHSVPQ
ALENVVLRATAKDPRDRYATAQAMQADLDSSLDPERADEPVFVPNHGNNNDKTIVLPGFK
APEKEQPTESDEETKPDKKEKKKDFWQNVKSHKWWWIFSIIATGLIIFIMIFALSGSNNK
PHQVHIPDVTNITEKSAEKKLEAAGLQIGKVVKRQSDDIKKGHVIGTKPAAGNSMDQGKA
IILIVSSGSSMVKVPNVVGDNYDEAAEKLENQGFDVVREDQYSNKVARDNIISQSIAAGV
EVKPTQTTITLVVSRGKKVKPKINTVTLKDLHNYSLKSAQDYAKEHGLTLQINQEYSDEV
EKGLVISMQPEAGTKVERGSTVTIKVSRGPKEEKDTTITKTFTVNYIGTDLNNDDKSDSK
SWDASNKEDSSKGDHVQIYIKDDDHSLSNIYRDLYIKRDMSFSIPFSLKNGNGQLRVVRN
RETVLNEKVTK
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgataaaggttatctgcttggtgaacgctatcgcattattgatactttaggcgaa
ggcggtatggctaatgtctatctagccgaagatattattctgcaacgcaaagttgcggtt
aaaatcctgcggttagatttacaaaatgaacctcaaactcaagctcgttttaaaagagaa
gctttagccacgagtgaattaagtcatcctaatattgtttctgttcttgatgtaggcact
gatcatggattgcattatatggtaatggaatatgttgatggtcctgatttaaaagaatat
attcaccaaaatgctcctttagatttgcatgaagtaattcgcatcatggacaaaatcctg
agcgctgttgctctggcccataaacataatgtgattcaccgtgatctcaagccgcaaaac
atcctgatggataagagaggcaatattaagattgctgatttcggaattgcggttgccttg
aatcagagctctgttacacagactaattctgttatgggatcagttcattatatgtcgccc
gaacagactagaggcgggttggttactaagcagtcagacatttattctttaggaattatt
ttgtatgaattgattacaggaaccgtgccatttaatggtgatactcctgtttcgattgcc
ttaaaacacgcgcaggaaccgataccttctattcgaaagaaggatcatagtgttccgcaa
gccttagaaaatgttgttttaagggctactgctaaagatccgcgagatcgttatgctaca
gctcaagcaatgcaggctgatttagatagcagtttagatccagaacgggcagacgagccg
gtttttgtacctaatcatggaaataataatgataaaacaatcgttttgcctggctttaaa
gctccagaaaaagagcagccgacagaatctgatgaagaaactaaacctgataaaaaagaa
aagaaaaaagatttttggcagaatgtaaagagccataaatggtggtggatcttttcaatc
attgctacaggattaattatctttattatgatctttgcactaagtggaagtaataataaa
ccacatcaagtgcatattccagatgtgaccaatataactgaaaaaagtgccgaaaagaaa
ttagaagctgctggcttgcaaataggcaaggtggttaagcgacaatctgatgatattaaa
aaaggacatgtcatcggtactaaaccagctgcaggtaatagcatggatcaaggaaaagct
attattttgatcgtatctagtggttcaagcatggtaaaagttcctaatgtagttggggat
aattatgatgaagctgcagaaaagctggaaaatcaaggctttgatgtagttagagaagac
cagtattcaaataaagtagctagagataatattatttctcaaagtattgctgctggggta
gaagtaaaaccaacgcagacaactattactttagtggtctctcgtggcaaaaaagtaaag
ccgaagataaacactgtaaccttgaaggatctgcacaattattcattgaagagtgcacag
gactacgctaaagaacatggtttgactttacagattaatcaagaatattctgatgaagtt
gaaaaaggcctggttatctcaatgcaaccagaggctggtaccaaggtggaacgtggatct
accgtaacaattaaggtttcacgcggtccaaaggaagaaaaagatactactattactaag
acatttactgttaattatataggcaccgatctcaataatgatgataaatccgatagcaag
agttgggatgcttctaataaagaagacagcagcaaaggtgatcatgttcagatttatatc
aaagatgatgatcactcgttaagtaatatctatcgtgacttgtatattaaacgtgatatg
agtttttcaattccattttctcttaagaatgggaatggtcaattacgagtagttcgtaat
agagaaactgttttaaatgaaaaggtgacaaaataa

DBGET integrated database retrieval system