KEGG   Listeria ivanovii subsp. londoniensis WSLC 30167: JL58_01675Help
Entry
JL58_01675        CDS       T03401                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lia  Listeria ivanovii subsp. londoniensis WSLC 30167
Pathway
lia00010  Glycolysis / Gluconeogenesis
lia00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JL58_01675
   00500 Starch and sucrose metabolism
    JL58_01675
Enzymes [BR:lia01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     JL58_01675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase Glyco_hydro_10
Motif
Other DBs
NCBI-ProteinID: AIS58768
UniProt: A0A097B282
LinkDB All DBs
Position
complement(364766..366181)
Genome map
AA seq 471 aa AA seqDB search
MHTNTGFPADFLWGGAAAANQFEGAYNVDGKGLTVQDVTPKGGFGHITDGPTPDNLKLEG
IDFYHRYKDDVKLFAEMGFKVFRTSIAWSRIFPNGDETEPNEAGLQFYDDLFDELLAHNI
EPLITLSHYETPLHLSKTYDGWVNRKMIDFYENYVRTVFNRYKGKVKYWLTFNEINSILH
APFMSGGISTSPDKLSQKDLYQAVHHELVASALATKIGHEIMPEAKIGCMVLAMPTYPLT
SNPDDIIAVMEAERKNYFFSDVHVRGTYPGYMKRYFAENNIELDVTEEDLEILKNTVDFI
SFSYYMSTTETADESKREKGAGNILGGVQNPYLEASEWGWQIDPKGLRVVLNDFWDRYQK
PLFIVENGLGAIDKLEEDADGNLTVNDDYRIDYLSSHLSQVKEAIKDGVELMGYTSWGCI
DLVSASTAEMKKRYGFIYVDRNNDGSGTLNRYKKKSFDWYKNVIASNGEDL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcatactaatacaggatttccagccgattttttatggggcggggcagctgcagcgaat
caattcgaaggcgcttacaatgttgatgggaaagggcttaccgttcaagatgttactcca
aaaggcggattcggccacatcactgacggccccacaccagacaacttaaaattagaagga
attgatttttatcaccgttataaagatgatgtaaaactttttgctgaaatgggcttcaaa
gttttccgtacatcgattgcttggtcacgtattttcccaaatggcgatgaaactgagcca
aatgaagcagggctacaattttacgatgatttattcgacgaacttttagcgcacaacatc
gaaccactcatcactttatctcattatgaaacaccacttcacttatcaaaaacatacgat
ggttgggttaatcgcaaaatgatcgacttctacgaaaattatgttcgcaccgtatttaat
cgttacaaaggaaaagtgaaatactggttaacatttaacgaaattaactcgattctacac
gcacctttcatgagtggcggaatttccacaagtcctgacaaattatctcaaaaagactta
tatcaagccgttcaccatgaacttgtggcaagcgcactagcaacaaaaattggtcatgaa
atcatgccagaagcaaaaatcggttgtatggttcttgcaatgccaacatacccacttact
tccaacccagacgacattattgcagttatggaagcagaacgcaaaaactatttcttctct
gatgtacatgtccgcggaacttacccaggatatatgaaacgctatttcgctgagaataat
atagaattagacgttactgaagaagacttagaaatccttaaaaacacagttgatttcatc
tctttcagctactacatgagcacaaccgaaacagcagatgaatcaaaacgcgaaaaaggc
gcaggaaatatcctaggcggtgtacaaaacccatacctagaagcatccgaatggggctgg
caaatcgaccctaaaggcttacgcgttgtcctaaacgacttctgggatagataccaaaaa
ccccttttcatcgtcgaaaacggtcttggtgctattgataaattagaagaagatgcagac
ggaaatctaacagttaacgacgattaccggattgattatttgagctcacacttatcgcaa
gtgaaagaagcgattaaagatggggttgagttgatgggttacacttcttggggttgtatt
gatttagttagtgcttctactgctgaaatgaagaaacgttatggttttatttatgtcgac
cgtaataatgatggcagtggtacgctaaatcggtataagaagaagagttttgattggtat
aagaatgtgattgcgagtaatggggaagatttgtaa

DBGET integrated database retrieval system