KEGG   Listeria ivanovii subsp. londoniensis WSLC 30167: JL58_07560Help
Entry
JL58_07560        CDS       T03401                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
lia  Listeria ivanovii subsp. londoniensis WSLC 30167
Brite
Enzymes [BR:lia01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     JL58_07560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIS59845
UniProt: A0A097BDD1
LinkDB All DBs
Position
complement(1576822..1577430)
Genome map
AA seq 202 aa AA seqDB search
MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVAGHADLASKPVEELVAN
LDSVPEDIRGAVRNHGGGHANHTLFWSILSPNGGGAPTGNLKAAIESEFGTFDEFKEKFN
AAAAARFGSGWAWLVVNNGKLEIVSTANQDSPLSEGKTPVLGLDVWEHAYYLKFQNRRPE
YIDTFWNVINWEEANKRFDAAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacttacgaattaccaaaattaccttatacttatgatgctttggagccgaattttgat
aaagaaacaatggaaattcattatacaaagcaccacaatacttatgtaacaaaattaaat
gaagcagttgcaggacacgcagatcttgcgagtaaacctgtagaagaattagttgctaat
ctagatagcgttcctgaagacattcgcggcgcagtacgtaaccatggtggtggacatgct
aaccatacattattctggtctattcttagcccaaatggtgggggtgctccaactggtaac
ttaaaagcagccatcgaaagcgaattcggcacatttgatgaattcaaagaaaaattcaat
gcggcagctgcagcacgttttggttcaggctgggcatggctagtagtgaacaatggtaaa
ctagaaatcgtttccactgctaaccaagattctccacttagcgaaggtaaaactccagtt
cttggcttagatgtgtgggaacatgcttattatcttaaattccaaaaccgtcgtcctgaa
tatattgacacattttggaatgttatcaactgggaagaagcaaacaaacgctttgatgca
gcaaaataa

DBGET integrated database retrieval system