KEGG   Listeria ivanovii subsp. londoniensis WSLC 30167: JL58_12115Help
Entry
JL58_12115        CDS       T03401                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lia  Listeria ivanovii subsp. londoniensis WSLC 30167
Pathway
lia00250  Alanine, aspartate and glutamate metabolism
lia00410  beta-Alanine metabolism
lia00430  Taurine and hypotaurine metabolism
lia00650  Butanoate metabolism
lia01100  Metabolic pathways
lia01110  Biosynthesis of secondary metabolites
lia01120  Microbial metabolism in diverse environments
lia02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    JL58_12115
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    JL58_12115
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    JL58_12115
   00430 Taurine and hypotaurine metabolism
    JL58_12115
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    JL58_12115
Enzymes [BR:lia01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     JL58_12115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC DUF3826
Motif
Other DBs
NCBI-ProteinID: AIS60683
UniProt: A0A097BFS6
LinkDB All DBs
Position
2512212..2513606
Genome map
AA seq 464 aa AA seqDB search
MLYSKENQESYLEPIFGSSAEDRDIPKYTLGKEPLEPRIAYQLVKDELLDEGSARQNLAT
FCQTYMEDEATKLMSETLEKNAIDKSEYPRTAELENRCVNIIADLWHAPKEQKFMGTSTI
GSSEACMLGGMAMKFTWRNRAEKLGLDIHAKKPNLVISSGYQVCWEKFCVYWDIDMRIVP
MDKDHMQLNTDQVLDYIDEYTIGVVGILGITYTGRYDDIYALNEKIEQYNSQTDYKVYIH
VDAASGGFFTPFVEPDIIWDFRLKNVISINTSGHKYGLVYPGIGWVLWKDENYLPKELIF
KVSYLGGEMPTMQINFSRSASHIIGQYYNFLRYGFEGYRTIHQKTSDVAQYLANAVKQTG
YFDIYNDGSHLPIVCYKLKEDANISWTLYDLADRLQMRGWQVPAYPLPKSLENVIIQRYV
CRADLGFNMAEEFIQDFKASIHELNNAHILFHDKQQSGVHGFTH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttatatagtaaagaaaatcaagaaagttatttagaacccatttttggatccagcgca
gaggatcgtgatattccaaaatatactctcggaaaagaacctttagaacctcgtatcgct
tatcaattagtgaaagatgaactattagatgaaggatctgctcgtcaaaatttagctact
ttttgccaaacatatatggaagacgaagctaccaaattaatgtccgaaaccttagaaaaa
aatgccattgataaatcggagtatccacgaacagcggaacttgaaaatcgctgcgttaat
attattgcagatttatggcacgcaccaaaagaacaaaaattcatggggacttctacaatt
ggctctagtgaagcttgtatgttaggtggaatggcgatgaaattcacttggcgaaatcgt
gcagaaaagctaggcctcgatattcatgccaaaaaaccaaaccttgtcatttcttccggt
taccaagtttgttgggaaaaattctgtgtttactgggatattgacatgcggatcgtacca
atggataaagaccatatgcaactaaataccgaccaagtgttagactatattgatgaatat
actatcggcgtcgtcggtatccttggtattacctacacgggacgttacgacgacatctac
gcccttaatgagaaaattgaacaatacaacagccaaacagattacaaagtatacatccac
gttgatgcagcaagcggaggtttctttaccccatttgtggaacctgacatcatttgggac
ttccgtttaaaaaatgttatttctattaacacttctggacataagtatgggttagtctat
cctggtattggctgggtgctttggaaggatgaaaactatttgccaaaagaactcattttc
aaagttagttatcttggcggagaaatgccaacaatgcaaatcaatttttctaggagcgct
agccatattatcggccaatattataatttcctacgctatggctttgaaggctaccggacc
attcatcaaaaaacaagtgatgttgcacaatatcttgcaaatgccgtaaaacaaactggt
tatttcgacatttataatgacggctcccatttgccaattgtctgctataaattaaaagaa
gatgcaaacattagttggacgctttacgatttagctgaccgcttgcaaatgcgcggatgg
caagtaccagcttatccactaccaaaaagtttagaaaacgttattattcaacgctatgtt
tgtcgagctgaccttggtttcaatatggctgaagaatttatccaagatttcaaagcttct
atccacgaactaaataacgcccacatccttttccatgataaacagcaatccggtgttcat
ggcttcacgcactaa

DBGET integrated database retrieval system