KEGG   Listeria ivanovii subsp. londoniensis WSLC 30167: JL58_13825Help
Entry
JL58_13825        CDS       T03401                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
lia  Listeria ivanovii subsp. londoniensis WSLC 30167
Pathway
lia00040  Pentose and glucuronate interconversions
lia00051  Fructose and mannose metabolism
lia01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    JL58_13825
   00051 Fructose and mannose metabolism
    JL58_13825
Enzymes [BR:lia01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     JL58_13825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C ApbA TrkA_N UDPG_MGDP_dh_N 2-Hacid_dh_C ThiF
Motif
Other DBs
NCBI-ProteinID: AIS60984
UniProt: A0A097BGK4
LinkDB All DBs
Position
complement(2827151..2828203)
Genome map
AA seq 350 aa AA seqDB search
MRAAVLYENNVIKAEQIDEAVCEKDQVRVEVKAVGICGSDIHKMQTRWKYPLPAVMGHEF
SGVITEVGSEVENRAIGDRVAGIPLEPCMECNYCKAGDFSLCDNYRMVGSHFHGGFAENV
VMKADNVISIGDLDFEEGAMIEPLAVSMHGVLGIEPRLGDTVIVFGIGTIGILVVQCLLL
AGVKDIIAVDISDKKLADAKEFGCRYTINPKNEDLKERVLAYTNGLGADIALECAGSKIT
QEQCLLVTKKKGKVGFLGIAYADVLLHEEAFENIFRRELTLKGFWNSYSAPFPGEEWRTS
IEFVKQGRIKLKPLISHRYKLEETKEAFEMILSREHDYNKVMILPQKGDD
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcagctgtgttatacgagaataatgtaataaaagcagaacaaattgatgaagcg
gtttgcgagaaagatcaagtacgtgtggaggtaaaagcggtcggaatatgcggatcagat
attcacaaaatgcagacgcgctggaaatatccactgccggctgttatgggacacgaattt
tcgggtgtgattacagaagtaggtagcgaagtggaaaatagagctatcggtgaccgtgtt
gcaggtattccactagaaccatgtatggaatgtaattattgtaaagcgggcgacttctcg
ctatgtgacaattaccgcatggtgggctcacatttccacggaggatttgccgaaaatgtg
gtaatgaaagctgataacgtcatttctattggcgaccttgattttgaagaaggtgcaatg
attgaaccactagctgtgtcaatgcatggggtacttggaatcgaaccaagacttggtgat
acagttatcgtgtttgggattgggacgattggaattttagtcgtgcaatgtttacttctc
gctggtgtgaaagatattatcgctgttgatatcagtgataagaagttagcagatgcgaag
gaatttggttgcagatacacgattaatccaaaaaacgaagacctgaaagaacgcgtttta
gcttatacgaatggtcttggtgctgacatcgcgctagaatgtgccggttccaaaatcacc
caagaacaatgtctccttgtaacgaagaaaaaaggcaaagttggtttcctcggaatagct
tacgcagatgtacttttacatgaagaagcttttgaaaatattttcagacgcgaattaacg
cttaaaggtttttggaactcttactcggcgccgtttccaggtgaagagtggcgtacttcg
atagaatttgtcaaacaaggtcgaattaaactaaaaccactgatttcgcatcgctataaa
ctagaagaaacgaaagaagcgtttgagatgattctttcaagagaacatgattataacaaa
gtgatgatattgcctcagaaaggtgacgattaa

DBGET integrated database retrieval system