KEGG   Legionella israelensis: E4T55_11165
Entry
E4T55_11165       CDS       T05938                                 

Definition
(GenBank) TIGR03747 family integrating conjugative element membrane protein
Organism
lib  Legionella israelensis
SSDB
Motif
Pfam: DUF4400
Other DBs
NCBI-ProteinID: QBS11142
LinkDB
Position
complement(2445670..2446275)
AA seq 201 aa
MTLHLALVVFLGWLCLLIWAVSQWALYGYSQAFNNVSSLVDNQRQAITPVYRGSLLSALP
LEPRFQLSLDHPYLAKLSFNEITADLVTKAQQFIKLMLLSSQCMLIKLMILLAAMPLFAL
AMLAGLVDGLNQRAIRTACLGRESSYVFHRLNHYFRKGLVIVLMIWLSMPISITPAYVFI
PISLMLALMVAMTASRFKKYL
NT seq 606 nt   +upstreamnt  +downstreamnt
atgacgttgcaccttgccctggtggtctttttgggctggttatgtttgctcatatgggcc
gtaagtcaatgggcattatatggatattcccaagctttcaataatgtaagctcactggta
gacaatcaaagacaagcaatcacaccagtatatcgaggatcattattatcagccctgcct
ttggaaccccgttttcagttatcactggatcacccttatcttgccaaactttcctttaac
gaaataaccgctgatttggtcacgaaagcacaacaatttatcaagctgatgctgctttcc
agccagtgcatgttaatcaaactcatgattcttttggctgccatgcccttatttgctctg
gctatgctcgcaggattagttgatggtttaaaccaaagagccatccgcacggcctgtctt
ggtcgtgagtcatcttatgtttttcaccgtttaaatcactacttcaggaaaggtttagtc
attgtattaatgatctggctttcgatgcctatcagtatcacaccagcttatgtgtttata
ccgattagtctcatgttggcgctgatggtagcgatgaccgccagtcgatttaagaaatat
ttataa

DBGET integrated database retrieval system