KEGG   Legionella israelensis: E4T55_11220Help
Entry
E4T55_11220       CDS       T05938                                 

Gene name
fabI
Definition
(GenBank) enoyl-ACP reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
lib  Legionella israelensis
Pathway
lib00061  Fatty acid biosynthesis
lib00780  Biotin metabolism
lib01100  Metabolic pathways
lib01130  Biosynthesis of antibiotics
lib01212  Fatty acid metabolism
Module
lib_M00083  Fatty acid biosynthesis, elongation
lib_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:lib00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    E4T55_11220 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    E4T55_11220 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    E4T55_11220 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lib01004]
    E4T55_11220 (fabI)
Enzymes [BR:lib01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     E4T55_11220 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     E4T55_11220 (fabI)
Lipid biosynthesis proteins [BR:lib01004]
 Fatty acid synthase
  Component type
   E4T55_11220 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: QBS10380
LinkDB All DBs
Position
2454567..2455322
Genome map
AA seq 251 aa AA seqDB search
MNSLKGLIVGIANEHSIAWGCAQALDKKGVELAITYQNEKTKEYVEPLIDKISCPIFLPL
DVRDETQLDNLVQSIKKKWGTLDFIIHAIAFAPKADLQGRVVDCSREGFTIAMDISCHSF
IRLAQAFEPLMQNGGSLITMSYYGAEKVIKNYNLMGPVKAALEASVRYLAAELGHKKIRV
NAISPGPIQTRAASGLADFDHLMEKAAKDAPLHQLVTTEAIGDAAVFLISPEGKYITGQV
IFVDGGYNIRG
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaattctttaaagggactaattgtaggtatcgctaatgagcattcaatcgcctgggga
tgtgcccaggctttagataaaaaaggggttgaacttgccatcacttaccaaaatgagaag
accaaagaatacgttgaaccattaatcgataaaatttcctgtcctattttcctgccactt
gatgtgagagatgaaactcagttagataacttggttcagagtatcaaaaagaaatgggga
acattagatttcatcattcatgccattgcctttgcacctaaagcagacctacaaggccga
gtcgttgattgttcgcgtgaagggtttacgattgctatggatatttcctgccactccttt
atacggcttgcccaggcttttgaacctttaatgcaaaacggcgggagtttaattaccatg
agttattatggtgcagaaaaggttatcaaaaattataacttaatggggccagttaaagct
gcactagaagcgtccgttcgctatctggcagccgagctcggtcataaaaaaattcgtgtc
aatgctatttcaccaggccccatacaaacacgagctgcatcagggttagccgattttgat
catttaatggaaaaagcagcaaaagatgcacctctacaccagttagttactacagaagct
attggagacgccgctgtctttcttatatcgccagaaggaaaatacattaccggtcaagtc
atttttgtggatggcggttataacataaggggttaa

DBGET integrated database retrieval system