KEGG   Leishmania infantum: LINJ_24_1700Help
Entry
LINJ_24_1700      CDS       T01112                                 

Definition
(RefSeq) putative succinate dehydrogenase flavoprotein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
lif  Leishmania infantum
Pathway
lif00020  Citrate cycle (TCA cycle)
lif00190  Oxidative phosphorylation
lif01100  Metabolic pathways
lif01110  Biosynthesis of secondary metabolites
lif01130  Biosynthesis of antibiotics
lif01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lif00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LINJ_24_1700
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LINJ_24_1700
Enzymes [BR:lif01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     LINJ_24_1700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 DAO HI0933_like GIDA FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 10966264
NCBI-ProteinID: XP_003392571
UniProt: E9AH70
LinkDB All DBs
Position
24:635731..637554
Genome map
AA seq 607 aa AA seqDB search
MLRRTFTRLALSRAYPVIDHTYDCVVVGAGGSGLRAAMGVAASGYDVACISKLYPSRSHT
IAAQGGINAALANCEEDDWRWHVYDTVKGSDWLGDQDAIQYMCQEAPCVVSELESMGLPF
LRTKDGFIYQRAFGGQSIHYGGKQARRTCAASDRTGHAMLHTLYGQSFQYGVNFYNEYYC
LDLIMEDGCCRGVMAMSIDDGTIHRFKSKYTVLCTGGYGRVYFTTTSAKSCTGDGTAMVA
RAGLPAEDMEFVQFHPTGIYGPGVLITEGARGEGGYLVNSEGERFMERYAPKAKDLASRD
VVSRAITMEILAGRGCGPKKDHVMLQLHHLDPATLHKKLPGISESAHIFAGVDVTKEPIP
IVPTVHYSMGGVPTLWTGEVISPRNGDDNAIVPGLLAAGECACASVHGANRLGANSLLDI
VVFGKSCANTVIFNLTKEGRKQPELRADAGEASIADLDRILNNKGDIPIARIRERMKETM
ALYAAVFRTEESMQTGKKIIEECYRDFSHAFVHDKSPVWNSNLIEALELRNLLTNAMMTI
SGAVVRKESRGAHARDDYQERDDHNWMKHTLAYLDDAKGKVRLAYRPVHMEMLTNEVESI
PPAKRVY
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgccgcacctttacgcgtcttgcccttagccgcgcctacccggtcatcgaccac
acgtacgactgcgtcgtcgtgggcgccggtggctctggtctccgcgcggccatgggtgtg
gcggcctctggctacgatgtggcgtgcatctcgaagctgtacccgtctcgctcgcacacg
atagcggcacagggtggcattaacgctgctctcgccaactgcgaggaggatgactggcgc
tggcatgtgtacgacacagtaaaaggctcggactggctcggtgaccaggatgcaatccag
tacatgtgccaggaggccccgtgcgttgtgtcggagctggaaagcatgggtctgcccttc
ctgcgcacaaaggacggcttcatctaccagcgcgcctttggtggtcagtcgatccactac
ggtggcaagcaggcgcgccgtacctgtgcggcgtcggaccgcacgggccacgccatgctt
cacaccctgtacggccagtccttccaatacggcgtgaacttctacaacgaatactactgc
cttgatctaatcatggaggatggctgctgccgcggtgtgatggccatgagcatcgacgat
ggtacgatccaccgcttcaaatcgaagtacacagtgctctgcacgggtggctacggccgc
gtgtacttcacgacgacaagcgcgaagagctgcacgggcgacggcacggccatggtggcg
cgcgccggcctgccggcggaggacatggagtttgtgcaattccatcccaccggtatctac
ggccctggcgtgctcatcactgagggcgcgcgcggcgagggtggctaccttgtgaacagc
gagggtgagcgcttcatggagcgctacgcccccaaggcgaaggatctggcgtcgcgcgat
gtcgtgtcccgggccattacgatggagattctggcggggcgcggctgcggccccaagaag
gaccacgtgatgctgcagctacaccacctcgaccctgccactctgcataagaagctgccg
ggcatctcagagagcgctcacatcttcgccggcgttgacgtgaccaaggagccgattccg
attgtgccaacggtgcactactcaatgggcggcgtgccgacactgtggacgggcgaggtg
attagcccgcgcaacggtgacgacaacgcgatcgtgcccggcctgctcgcagctggtgag
tgcgcctgcgctagcgtgcacggcgccaaccgcctcggcgcgaactcgctgctggacatt
gtcgtgttcggcaagtcgtgcgccaacacggtcatctttaatctgacgaaggagggccgc
aagcagcccgagctgcgcgccgacgccggcgaggcctcgatcgccgatctggaccgcatc
ctcaataacaagggcgacattcccatcgcccgtatccgtgagcgtatgaaggagacgatg
gcactctacgccgccgtattccgcacagaggagagcatgcaaacaggaaaaaagataatc
gaggagtgctaccgagacttctctcacgccttcgtgcacgacaaatcaccggtgtggaac
agcaacctcattgaggcgctcgagctgcgtaacctgctgacgaacgccatgatgacgatt
agcggcgctgtggtgcgcaaggagagccgcggtgcccacgcacgtgacgactaccaagag
cgtgacgaccacaactggatgaagcacaccctcgcatacctggacgacgccaagggcaag
gtgcgccttgcgtaccgcccggtgcacatggagatgctgacgaatgaggtggagagcatc
ccgccggcgaagcgagtgtactag

DBGET integrated database retrieval system