KEGG   Leishmania infantum: LINJ_27_0620Help
Entry
LINJ_27_0620      CDS       T01112                                 

Definition
(RefSeq) putative small GTP-binding protein Rab1
  KO
K07874  Ras-related protein Rab-1A
Organism
lif  Leishmania infantum
Brite
KEGG Orthology (KO) [BR:lif00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lif04131]
    LINJ_27_0620
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lif04147]
    LINJ_27_0620
   04031 GTP-binding proteins [BR:lif04031]
    LINJ_27_0620
Membrane trafficking [BR:lif04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab GTPases
    LINJ_27_0620
 Autophagy
  Other autophagy associated proteins
    LINJ_27_0620
Exosome [BR:lif04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LINJ_27_0620
  Exosomal proteins of other body fluids (saliva and urine)
   LINJ_27_0620
  Exosomal proteins of colorectal cancer cells
   LINJ_27_0620
GTP-binding proteins [BR:lif04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab1/35 [OT]
    LINJ_27_0620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ras Roc Arf RsgA_GTPase Gtr1_RagA SRPRB GTP_EFTU MMR_HSR1 FeoB_N AAA AAA_16 ABC_tran G-alpha AAA_22 AAA_29 TniB AAA_7 AAA_5
Motif
Other DBs
NCBI-GeneID: 10966266
NCBI-ProteinID: XP_003392649
UniProt: E9AHE8
LinkDB All DBs
Position
27:307568..308170
Genome map
AA seq 200 aa AA seqDB search
MTAEYDYLFKLLLIGDSGVGKSCLLLRFADDSYTDSYISTIGVDFKIRTLNLESKVIKLQ
IWDTAGQERFRTITSSYYRGAHGIIIVYDTTDMESFNNVKTWLSEIEKYASENVNKILVG
NKCDLVTKKAVDTQMAKDFADSLGIPFLETSAKNSTNVEEAFIQMASGIKARLAVSGEVK
SASRPNLQNPPTVKKEDSCC
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctgagtacgactacctcttcaagctgctgctgattggcgacagcggcgtcggt
aagtcctgcctgctcctccgcttcgccgatgacagctacaccgatagctacatctccacc
attggtgtcgacttcaagattcgcacgctgaacctggaaagcaaggtaatcaagctgcag
atttgggataccgccggccaggagcgcttccgcaccatcacgagtagctactaccgtggt
gcccacggcatcatcatagtgtatgacacgaccgacatggagagtttcaacaacgtcaag
acgtggctgagcgaaatcgaaaagtacgcaagtgagaacgtcaacaagatcctcgtcggc
aacaagtgcgatttggtcacaaagaaggccgtcgatacgcagatggcgaaagactttgcc
gactcccttggcatcccgttccttgaaacgagcgccaagaactccacaaacgtcgaggaa
gccttcattcaaatggcatctggaatcaaggcgcgcctggctgtgagtggtgaggtcaaa
tctgcgtcccgtcccaacctgcagaaccccccaacggtgaagaaggaagacagctgctgc
taa

DBGET integrated database retrieval system