KEGG   Limnohabitans sp. 63ED37-2: L63ED372_00171Help
Entry
L63ED372_00171    CDS       T04121                                 

Gene name
dacB
Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase DacB precursor
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
lih  Limnohabitans sp. 63ED37-2
Pathway
lih00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lih00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    L63ED372_00171 (dacB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lih01002]
    L63ED372_00171 (dacB)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lih01011]
    L63ED372_00171 (dacB)
Enzymes [BR:lih01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     L63ED372_00171 (dacB)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     L63ED372_00171 (dacB)
Peptidases [BR:lih01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   L63ED372_00171 (dacB)
Peptidoglycan biosynthesis and degradation proteins [BR:lih01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   L63ED372_00171 (dacB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: ALK87400
UniProt: A0A0N7J874
LinkDB All DBs
Position
complement(190700..192280)
Genome map
AA seq 526 aa AA seqDB search
MSATRAKRLFLSTLTHATAAPRAAGFAWAIAVGCILAWPAFAQNRSESAEAQTLTNQART
TLPRHVLQTLEKAQVPPSALSVLIAPLPQGPTSNSAQPRHLSHQAQASVNPASVMKLFTT
YAGLILLGPDHVWRNRVYTDGPVRDGVLQGNLVVRGSGDPKLVVERLQELLTQVRSAGVR
DVRGDIVLDRSVFDVRERSEPFDDEPLRPYNVGPDGLLLNFKAVVYKFTPDAASGQVQVR
FEPPLAGFSAPTQLPLSQTPCSDWRRQLQADFSQPQQVRFAGRYPASCGEREWPVAYPEP
EAYAPRVMQALWQQAGGQLTGQVRYGSRPASAKLLLEAPSLPLSDIIQDINKFSNNVMAQ
QLYLTLSSELGAPGRFEASRLRLSQWWRQGFAVHDEPVLDNGSGLSRTERSTAQALTALL
QAAHSSPHARHFVNSLAIAGVDGTAARLKDRSPQSPVIGNAWLKTGSLRDVASVAGYVQG
QSGQRYTLVAVLHHPNAHQARAALDQLLEWTVRDTTSPRAKAPQTP
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccacccgcgccaagcgcctatttttgtccacgctcacccacgccaccgctgcg
cctcgtgcagcgggttttgcatgggccatcgcagtgggctgcatattggcttggccagct
ttcgcccaaaaccgctccgagtcggcagaagcccagaccctcaccaaccaagcccggacc
acactgccccggcatgttctgcaaaccctggaaaaggcccaagttccgccttcggccctg
agcgtgctcatcgcccccctgccccaaggtcctacgtccaacagcgcccaacctcggcat
ttgtcgcaccaagcccaagccagcgtgaaccctgcttcggtcatgaagctgttcaccacc
tatgcgggtttgatcctgctggggcccgaccacgtctggcgcaatcgggtgtacaccgat
ggcccggtgcgtgatggggtgctgcagggcaatctggtcgtgcgcggcagcggcgacccc
aagctggtggttgagcgcctgcaagagctgctgacccaggtccgatcagcgggcgtgcgc
gacgtgcgcggtgacatcgtgctggaccgcagcgtgttcgacgtgcgcgagcgcagcgag
ccctttgacgacgaacccctgcggccctacaacgtgggcccagacgggttgctgctcaac
ttcaaggcggtggtctacaaattcacgcccgacgccgccagcggccaggtgcaggtgcgc
tttgaaccgcccctggccgggttctcggcccccacgcaactgccactgagccagacccca
tgcagtgactggcgacgccagctgcaggccgacttcagccagccgcaacaagtgcgcttt
gcgggccgctacccggccagctgcggtgagcgcgaatggcccgtggcctaccccgaaccc
gaagcctatgccccccgggtcatgcaagccctgtggcaacaagcgggcgggcaactcacg
gggcaggtgcgctacggctcgcgcccagcatcggccaagctgctgctggaagcgccctcc
ttgcccttgtccgacatcattcaggacatcaacaagttctcgaacaacgtgatggcgcag
cagctgtacctgacgctgtcgagcgagctgggcgcacccgggcggtttgaggcctcgcgc
ttgcgcctgtcgcagtggtggcgtcaaggctttgccgtgcacgatgaaccggtgctggac
aacggctcgggcctgtcccgcaccgagcgcagcaccgcgcaggctttgacggctttgctg
caagccgcacactccagcccgcacgcccggcactttgtcaactccttggccatcgccggg
gtggacggcaccgccgcccgactcaaagaccgcagcccgcagtcgcccgtgatcggcaac
gcctggctcaaaaccggttcgctgcgcgatgtggcctcggtggccggttatgtgcagggc
caaagcggccagcgctacaccctggtggccgtgctgcaccaccccaatgcccaccaggcc
cgggccgcactcgaccaattgctggagtggacggtgcgcgacaccacctctccccgggcc
aaagcgccccaaacaccctaa

DBGET integrated database retrieval system