KEGG   Limnohabitans sp. 63ED37-2: L63ED372_00176Help
Entry
L63ED372_00176    CDS       T04121                                 

Gene name
tktA_1
Definition
(GenBank) Transketolase 1
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
lih  Limnohabitans sp. 63ED37-2
Pathway
lih00030  Pentose phosphate pathway
lih01100  Metabolic pathways
lih01110  Biosynthesis of secondary metabolites
lih01120  Microbial metabolism in diverse environments
lih01130  Biosynthesis of antibiotics
lih01200  Carbon metabolism
lih01230  Biosynthesis of amino acids
Module
lih_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
lih_M00165  Reductive pentose phosphate cycle (Calvin cycle)
lih_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
lih_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:lih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    L63ED372_00176 (tktA_1)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    L63ED372_00176 (tktA_1)
Enzymes [BR:lih01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     L63ED372_00176 (tktA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh
Motif
Other DBs
NCBI-ProteinID: ALK87405
UniProt: A0A0P0M6U2
LinkDB All DBs
Position
195614..197644
Genome map
AA seq 676 aa AA seqDB search
MANQAQMANAIRALAMDAVQQANSGHPGAPMGMADMAVALWGDHLQHNPKNPHWANRDRF
VLSNGHGSMLIYSVLHLTGYKLPIEELKNFRTLHSKTAGHPEVGVTPGVETTTGPLGQGI
TNAVGMALAEKMLAAEFNQPGHTIINHHTYVFLGDGCLMEGISHEAVALAGAWKLNKLIA
LYDDNGISIDGQVAPWFIDNTPQRFAACGWNVIDAVDGHDAAAVSKAIAAAKHSADKPTL
IVCKTAIGKGSPNRAGTSKAHGEPLGAEEIKLTREALGWTAEPFKIPKEVYADWDAKAAG
AAREAAWNTAFAAYKAAFPAQAKEFVRRMKGDLPKNFNQVAFDAVVAAHTKGETVASRKA
SQLALEAFTAALPEMLGGSADLTGSNLTNTKSTPAFRVDLAGDVVKTEEGQIGRHINYGV
REFGMAAIMNGVALHGGYIPYGGTFLTFSDYSRNAIRMAALMKQRVVHVFTHDSIGLGED
GPTHQSIEHAASLRLIPGLDVWRPADTAETTVAWAVALQNAHRPSALLLSRQNLAYSPKS
DLGDISRGAYVLSEPEHVGIKKTHGVIIATGSEVQLALAAQKLLAERKIGVRVVSMPSTN
VFDRQDTEYKQSVLPKGLPRVAVEMGSTDGWWKYGCAAVVGIDTYGESAPAPVLFKHFGF
TAENVADTVHAALLKA
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggccaatcaagcacaaatggcgaacgccatccgcgccctcgcaatggacgccgttcaa
caagccaactccggtcaccccggcgcgcccatgggcatggccgacatggctgtcgcgctg
tggggcgatcacctgcaacacaaccccaaaaacccgcactgggccaaccgcgaccgcttt
gtgctgtccaacggccacggctcgatgctgatttattcggtgctgcacctgaccggctac
aaactgccgattgaggaactcaaaaacttccgcaccctgcacagcaaaaccgcaggccac
cccgaagtgggcgtgacccccggcgtggaaaccaccaccggccccttgggccaaggcatc
accaacgccgtgggcatggccctggccgaaaaaatgctggccgccgagttcaaccagcct
ggccacaccatcatcaaccaccacacctacgtgttcttgggtgacggctgcttgatggaa
ggcatcagccacgaagccgtggctctggccggtgcctggaagctgaacaaactgattgcc
ctgtacgacgacaacggcatctccatcgacggccaagtggccccttggttcatcgacaac
acgccccaacgctttgccgcctgcggctggaacgtgatcgacgccgtggacggccacgac
gcagcggccgtctccaaggccatcgccgccgccaagcacagcgccgacaagccgacgttg
atcgtctgcaagaccgccatcggcaagggctcgcccaaccgtgcaggcacctccaaagcc
cacggcgagcctttgggcgctgaagaaatcaagctcacccgcgaagccctgggctggacg
gccgagcctttcaagatccccaaagaggtgtatgccgactgggacgccaaagccgctggc
gcagcccgcgaagccgcctggaacaccgcatttgccgcgtacaaagccgccttccccgca
caagccaaagagtttgtgcgccgcatgaagggcgacttgcccaagaacttcaaccaggtg
gcgtttgacgccgtcgtggctgcccacaccaagggcgaaaccgtggccagccgcaaggcc
agccaactggcgctggaagccttcaccgccgctctgcccgaaatgctgggtggctcggcc
gacctgaccggctccaacctgaccaataccaagagcaccccagccttccgcgtggacctg
gctggcgatgtggtcaaaaccgaagaaggccagatcggtcgccacatcaactacggcgtg
cgcgaattcggcatggccgccatcatgaacggcgtggccctgcacggcggctacatccct
tacggcggcaccttcctcaccttttctgactattcgcgcaacgccatccgcatggccgcg
ctgatgaagcagcgcgtggtgcacgtgttcacccacgactccatcggtctgggcgaagac
ggcccgacccaccagtccatcgagcacgcggccagcctgcgcctgatccctggcttggac
gtgtggcgtcccgccgacacggccgaaaccaccgtggcctgggccgtggccctgcaaaac
gcccaccgcccatcggccctgctgctcagccgccaaaacctggcttactcacccaagagc
gatttgggcgacatcagccgtggcgcgtatgtgctgtccgagcccgagcacgttggcatc
aagaaaacccacggcgtgatcatcgccaccggctctgaagtgcaactggccctggccgcg
caaaagctgctggccgaacgcaagatcggtgtgcgcgtggtctccatgcccagcaccaat
gtgtttgaccgccaagacaccgaatacaaacaaagcgtgttgcccaaaggcctgccccgc
gtggcggtcgagatgggctccaccgacggctggtggaaatacggctgcgccgccgtggtc
ggcatcgacacctacggcgagtcggccccagcgcccgtgctgttcaaacatttcggcttt
accgccgagaacgtggccgacaccgtccacgctgcgctgctcaaggcctga

DBGET integrated database retrieval system