KEGG   Limnohabitans sp. 63ED37-2: L63ED372_00605Help
Entry
L63ED372_00605    CDS       T04121                                 

Gene name
fadB_1
Definition
(GenBank) Fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
lih  Limnohabitans sp. 63ED37-2
Pathway
lih00071  Fatty acid degradation
lih00280  Valine, leucine and isoleucine degradation
lih00281  Geraniol degradation
lih00310  Lysine degradation
lih00362  Benzoate degradation
lih00380  Tryptophan metabolism
lih00410  beta-Alanine metabolism
lih00640  Propanoate metabolism
lih00650  Butanoate metabolism
lih00903  Limonene and pinene degradation
lih00930  Caprolactam degradation
lih01100  Metabolic pathways
lih01110  Biosynthesis of secondary metabolites
lih01120  Microbial metabolism in diverse environments
lih01130  Biosynthesis of antibiotics
lih01200  Carbon metabolism
lih01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    L63ED372_00605 (fadB_1)
   00650 Butanoate metabolism
    L63ED372_00605 (fadB_1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    L63ED372_00605 (fadB_1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    L63ED372_00605 (fadB_1)
   00310 Lysine degradation
    L63ED372_00605 (fadB_1)
   00380 Tryptophan metabolism
    L63ED372_00605 (fadB_1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    L63ED372_00605 (fadB_1)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    L63ED372_00605 (fadB_1)
   00281 Geraniol degradation
    L63ED372_00605 (fadB_1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    L63ED372_00605 (fadB_1)
   00930 Caprolactam degradation
    L63ED372_00605 (fadB_1)
Enzymes [BR:lih01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     L63ED372_00605 (fadB_1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     L63ED372_00605 (fadB_1)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     L63ED372_00605 (fadB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_binding_2 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ALK87832
UniProt: A0A0N7J8C8
LinkDB All DBs
Position
637378..639537
Genome map
AA seq 719 aa AA seqDB search
MILKTLRYELADGLATITFDEQGSPVNTMCLQWQDDLAQAAEQVAKDKAALKGVILASAK
STFFAGADLKGVMRSKASDGPRVFADIEGIKKAFRTIETLGVPVVSCLNGSALGGGWEVA
LIGHHRIATANPKTQFGLPEVTLGLIPGGGGITKMTRQLGLLAAQPYVLESKLFGPEEAQ
KLGLVHEIVASDDQLRPRALAHIAASQGQPEAAQHPWDRKDYKMPGGTPSNPKIAGMLSV
APAVLKQKTRGLYPAPEAALAAMVEGAMVDFDTAMRIESRYLAGLMTSQVARNMINTFFF
NMNSIKGGQSRPKAAPRYKPQKVGILGAGMMGSGIAHSQASRGIATVLKDVSLEAAEKGK
AYSHKLTQKRVDKGRMTADKQAALLSLIQPTASAADLKGCDLIIEAVFENRELKARVTQE
AEPMLAEGGFFASNTSTLPISGLATASANANKFVGIHFFSPVDKMQLVEIIRGAQTDDET
IARAYDYVQALGKLPIVVNDSRGFYTSRTFGTFVMEGAAMLGEGIPAPVIENLAMQVGMP
VGPLAVLDETALSLSVHVLDQTREDFSKEGKTYTATPGELLVERMVKELKRPGRAAGGGF
YDYPAGQKKVLWPELKTRFEKADVAYSQQDIKDRLLYRQAVETARCLQEGVLTSVHDGNI
GSIFGIGFPAWTGGALQFIYGQGVDAFAKRCAELAALYGAGFALTAEVIASLKQHQPVY
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgattttgaaaacattgcgctacgaactggcggacggcctcgccaccatcacctttgac
gagcagggctcgccggtcaacaccatgtgcctgcaatggcaggacgacctggcccaggcg
gccgagcaggtggccaaagacaaggcggcattgaaaggcgtcatcctggcctctgccaag
tcaaccttttttgcgggggccgacctcaagggcgtgatgcgctccaaagcctcagacggc
ccgcgtgtctttgccgacatcgaaggcatcaagaaagcttttcgcaccatcgagacgctg
ggcgtgcccgtggtcagctgcctcaatggctcggccctcggtggcggctgggaagtggcg
ctgatcggccaccaccggatcgccaccgccaaccccaaaacacagttcggtttgcccgaa
gtcacgctgggcttgattcctggtggcggcggcatcaccaaaatgacccgccagttgggc
ctgctggccgcgcagccctatgtgctggagagcaaactctttggccccgaagaggcgcaa
aagctgggcctggtgcacgagatcgtggccagcgacgaccagctgcgcccccgcgctctg
gcgcacattgcggcaagccaaggccagcccgaagcggcccaacacccgtgggaccgcaag
gactacaaaatgcccggcggcacgccgagcaaccccaagatcgcgggcatgttgagtgtg
gcccctgccgtgctcaagcaaaaaacacgcggcctgtaccccgcgcccgaagcggcgctg
gccgccatggtcgaaggcgcgatggtggactttgacaccgccatgcgcatcgaaagccgt
tacctcgctggcttgatgaccagccaggtggcgcgcaacatgatcaacaccttcttcttc
aacatgaacagcatcaagggcggccaaagccgccccaaggctgcaccgcgctacaagccc
caaaaagtgggcatcttgggcgcaggcatgatgggctcgggcattgcgcattcacaagcc
agccggggcatcgccacagtgctcaaagacgtgagcttggaagccgctgaaaaaggcaag
gcctacagccacaagctcacgcaaaaacgcgtggacaaaggccgcatgactgcagacaaa
caagcggccttgttgtcactcatccagcccacggccagcgccgctgatctcaagggctgc
gacctgatcatcgaagccgtgtttgaaaaccgcgaactcaaggcccgtgtcacgcaagag
gccgagcccatgctggccgaaggcggcttctttgccagcaacacctccaccttgcccatc
agcggcctggccacggccagcgccaacgcgaacaaattcgtcggcatccacttcttcagc
cccgtcgacaagatgcagctggtggagatcattcgcggcgcacagaccgacgacgagacg
attgcccgcgcatacgactacgtgcaggcgctgggcaagctgcccatcgtggtgaacgac
tcgcgtggcttttacaccagccgcaccttcggcacctttgtgatggaaggcgcggccatg
ctgggcgagggcatccccgcccccgtgatcgaaaacctggccatgcaagtcggcatgccg
gttgggccactggccgtgctggacgaaacggcgctgtctttgtcggtgcatgtgctggac
caaacccgcgaagacttctccaaggaaggcaaaacctacaccgccacgcccggcgaactg
ctggtcgagcgcatggtcaaagaactcaagcgccccggccgcgccgcaggcggtggtttt
tacgactaccccgctggccagaaaaaagtgctgtggcctgaactgaaaacccgctttgaa
aaagctgacgtggcctatagccagcaagacatcaaagaccgcctgctgtaccgccaagcg
gtagaaaccgcccgctgcctgcaagaaggcgtgctgacctcggtgcacgacggcaacatc
ggctcgatttttggcatcggctttccggcctggacgggtggggcgctgcaattcatctat
ggccaaggtgtggatgcgtttgccaagcgttgcgctgaactggcggcgttgtatggggcg
ggttttgcgctgacggcggaagtcattgcgagcttgaagcagcatcagccggtgtattga

DBGET integrated database retrieval system