KEGG   Limnohabitans sp. 63ED37-2: L63ED372_00732Help
Entry
L63ED372_00732    CDS       T04121                                 

Gene name
ydhV
Definition
(GenBank) putative oxidoreductase YdhV
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
lih  Limnohabitans sp. 63ED37-2
Pathway
lih00030  Pentose phosphate pathway
lih01100  Metabolic pathways
lih01120  Microbial metabolism in diverse environments
lih01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    L63ED372_00732 (ydhV)
Enzymes [BR:lih01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     L63ED372_00732 (ydhV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N tRNA-synt_1_2
Motif
Other DBs
NCBI-ProteinID: ALK87958
UniProt: A0A0P0M7N5
LinkDB All DBs
Position
766825..768672
Genome map
AA seq 615 aa AA seqDB search
MSWAGKILRVNLTAGTVKSEPLNMEWAKAYLGSRGLGSKYLISEIDPKVDPLSADNKIVW
ATGPLTGTMASTGGRYTVITKSPLTGAIACSNSGGYWGAELKMAGWDMVIFEGASAKPVY
LHISDDEAELRDASHLWGQSVWKTEEILKSSLQDPLLRVCSIGKAGENGVLYAAVVNDLH
RAAGRSGVGTVMGSKNLKAIAVRGTKGVGNIQNPKAFMAAAKAAKKVLADNAVTGQGLPA
YGTQVLMNVINEVGGLPTRNHRDVQFESAKDISAEAMVTPRETDGKKHLVTNQACFGCTI
ACGRISKIDEGHFSVKNKPEYWGANGGLEYEAAWALGAANGVKDLEALQYANMICNEEGF
DPISFGATIGAVMELYEMGVLTKEQIGVEAPFGSAQALCEFVDMTAKGIGFGKEIGMGSK
RLTAKYGHPDLSMSVKGQEFPAYDGRVIQGIGLAYATSNRGACHLRGYTIASEVLGIPVK
TEPTEHEGKPELVKAFQDATAAFDSAGICVFTSFAWTLADVAPQVQAACGEEFTMEHLNH
IGERIWNMERDFNNAAGFTKADDNLPKRLMTEAAKTGPGKGMVSKLDEMLPKYYDARGWD
GEGRPTSATRERLGL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggctggaaaaattctccgcgtcaacctcacggctggcaccgtcaaatccgaa
ccgctgaacatggagtgggccaaggcctacctcggctcacgcggtttgggcagcaaatac
ctgatcagcgagatcgaccccaaagtcgacccgctgtcggctgacaacaaaatcgtctgg
gccacaggcccactgaccggcaccatggcctccactggcggccgttacaccgtcatcacc
aagagcccactgactggcgcaatcgcttgctccaactcgggtggctattggggcgctgag
ctcaaaatggccggttgggacatggtcatttttgaaggtgcatcggccaagcccgtgtac
ctgcacatcagcgacgacgaagccgagttgcgcgatgcgagtcacctgtggggccaaagt
gtctggaagaccgaggaaattctcaagtccagcttgcaagacccgctgctgcgtgtctgc
agcatcgggaaggctggcgaaaacggcgtgctgtatgccgccgtggtgaacgacctgcac
cgcgcggctggccgctccggcgtgggcaccgtcatgggcagcaagaacctcaaagccatt
gcggtgcgcggcaccaagggcgtgggcaacatccaaaaccccaaggctttcatggctgcg
gccaaggcggccaaaaaagtgctggccgacaacgcggtcacgggacagggcctgccggct
tatggcacccaggtgctgatgaacgtgatcaacgaagtgggcggtttgcccactcgcaat
caccgtgatgtgcaattcgaaagcgcgaaagacatctcggccgaagccatggtcacgccc
cgcgagaccgacggcaaaaagcacctggtgaccaaccaagcttgctttggttgcaccatc
gcctgcgggcgcatcagcaagatcgatgagggccacttctcggtcaagaacaagcctgag
tattggggcgccaacggcggcctggaatacgaagcagcttgggcgttgggcgcagccaac
ggcgtgaaagacctcgaagccctgcagtacgccaacatgatctgcaacgaagaaggcttt
gacccgatcagcttcggtgccaccatcggtgcggtgatggaactctacgaaatgggcgtg
ctgaccaaagagcaaatcggtgtggaagcaccctttggctcggcccaagcgctttgcgag
ttcgtcgacatgacggccaagggcattggttttggcaaggaaattggcatgggctccaag
cgcctgaccgccaaatatggccaccccgacctgtccatgagcgtcaagggccaggaattt
ccggcctatgacggtcgtgtgatccaaggcattggcttggcttacgccacgtccaaccgt
ggtgcttgccacctgcgcggctacaccatcgcctctgaagtgctgggcatcccggtcaag
accgagcccaccgagcacgaaggcaagcccgagttggtcaaggccttccaggatgcaacc
gccgcctttgactcggccggcatttgcgtcttcaccagctttgcctggactttggctgac
gtggcgcctcaggtgcaagccgcttgcggcgaagagttcaccatggagcacctgaaccac
atcggtgagcgcatctggaacatggagcgcgacttcaacaacgccgccggcttcaccaag
gccgacgacaacctgcccaagcgcctgatgaccgaagccgccaaaaccggccccggcaaa
ggcatggtcagcaagttggacgaaatgctgcccaagtactacgacgcccgcggctgggat
ggcgaaggccgtccaacatcggccacccgggaacgtctgggtttgtga

DBGET integrated database retrieval system