KEGG   Limnohabitans sp. 63ED37-2: L63ED372_01061Help
Entry
L63ED372_01061    CDS       T04121                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lih  Limnohabitans sp. 63ED37-2
Brite
KEGG Orthology (KO) [BR:lih00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    L63ED372_01061 (ahpF)
Enzymes [BR:lih01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     L63ED372_01061 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 FAD_oxidored DAO Glutaredoxin NAD_binding_8 FAD_binding_3 AlaDh_PNT_C Thi4 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ALK88275
UniProt: A0A0P0LPR3
LinkDB All DBs
Position
1097196..1098800
Genome map
AA seq 534 aa AA seqDB search
MLDDTLKAQLQQYLALLRQPIRLIASLDDSETGGDMKNLLETIVGLSDKVTLDTTGDDAR
KPSFVVAREGQSTGVRFAGLPLGHEFTSLVLALLWTGGHPPKVEQDVIDSIKALDGDFNF
EVYMSLSCHNCPDVVQALSLMAIVNPNVKTVVIEGGAFQAEVEARQIMAVPMVFLNGQVF
GSGRMSVEEIVAKIDTNAGERDAAKLTAKDPFDVLIVGGGPAGAAAAVYAARKGIRVGVA
AERFGGQTNDTMAIENYISVLETDGPKFAAALEAQVRHYEVDIMNLQRADKIIPASQPGG
LIEVQMANGASLKARSVILSTGARWRNVNVPGEAEYKNKGVAYCPHCDGPLFKGKRTAVI
GGGNSGIEAAIDLAGIVAHVTVFEFADQLKADAVLVSKLKSLPNVTIHTNAQTTEITGAD
GKVNGIRYKDRITGDDHWVELEGVFVQIGLVPNTEFLKGTLELSKFGEIVVDAKGHTNVP
GVFAAGDCTTVPYKQIVIAAGEGAKAALSAFDHLIRLPALPVNDTTTTAHAEAV
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgacaccctcaaagcccaattgcagcaataccttgccctgttgcgccagccg
attcgcctgatcgcttcgctggacgacagcgagaccggcggcgacatgaaaaacctgttg
gaaaccatcgtgggtctgtccgacaaggtgacgctggacacaacgggtgacgatgcccgt
aagccatcatttgtggtggcgcgtgaaggccaaagcaccggtgtgcgctttgccggtttg
ccgctgggccacgagttcacatcgctggtgttggccttgctctggaccggtggtcatccc
ccgaaggtcgagcaagacgtgatcgacagcatcaaggccctggatggcgacttcaatttc
gaggtctacatgtcgctcagctgccacaactgccccgacgtggtgcaggcgctgtcgctc
atggccatcgtgaacccgaatgtgaagaccgtggtcatcgaaggcggcgccttccaggcc
gaagtcgaagcacgccagatcatggccgtgcccatggtgttcctgaacggtcaggtgttc
ggttcgggccgcatgtcggtcgaagaaatcgtggccaagatcgacaccaacgccggtgaa
cgcgacgcggccaagctgaccgccaaagacccctttgacgtgttgatcgtgggcggtggc
ccggccggtgctgcagctgccgtgtacgcggcccgtaaaggcattcgtgtgggcgtggcg
gctgagcgttttggcggccagaccaacgacaccatggccatcgagaattacatctcggtg
ctggagaccgacggtcccaagtttgcggcggctctggaagcacaagtgcgccactacgag
gtggacatcatgaacttgcagcgtgccgacaagatcattcccgccagccagcccggtggc
ctgatcgaagtgcagatggccaatggtgccagcctcaaggcccgctcggtcatcctgtcc
accggcgcccgctggcgcaatgtcaacgtgcccggcgaagccgagtacaaaaacaagggc
gtggcttactgcccgcactgcgacggccccttgttcaagggcaagcgcaccgccgtgatt
ggcggcggcaactccggcatcgaagcggcaatcgacctggccggcatcgtggcccacgtc
acggtgtttgaatttgccgaccagctcaaggccgacgcagtcttggtgagcaagctcaag
agtctgcccaacgtcacgatccacaccaacgcccaaaccaccgaaatcaccggtgccgac
ggcaaggtcaatggcattcgttacaaagaccgcatcacgggtgatgaccactgggtggag
ctcgaaggcgtgttcgtgcaaattggtctggtgcccaacaccgagttcctcaaaggcacc
ttggagttgagcaaatttggcgagatcgtggtggacgccaaaggccacaccaatgtgccc
ggcgtgtttgcagccggtgactgcaccaccgtgccttacaagcagatcgtcattgccgca
ggcgagggcgccaaagccgccttgagcgcttttgaccacctgatccgtttgcctgctttg
ccggtgaatgacaccacaacaaccgcgcacgcagaagccgtttaa

DBGET integrated database retrieval system