KEGG   Limnohabitans sp. 63ED37-2: L63ED372_01513Help
Entry
L63ED372_01513    CDS       T04121                                 

Gene name
icd
Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
lih  Limnohabitans sp. 63ED37-2
Pathway
lih00020  Citrate cycle (TCA cycle)
lih00480  Glutathione metabolism
lih01100  Metabolic pathways
lih01110  Biosynthesis of secondary metabolites
lih01120  Microbial metabolism in diverse environments
lih01130  Biosynthesis of antibiotics
lih01200  Carbon metabolism
lih01210  2-Oxocarboxylic acid metabolism
lih01230  Biosynthesis of amino acids
Module
lih_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lih_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:lih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    L63ED372_01513 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    L63ED372_01513 (icd)
Enzymes [BR:lih01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     L63ED372_01513 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ALK88721
UniProt: A0A0P0LR47
LinkDB All DBs
Position
1582624..1584858
Genome map
AA seq 744 aa AA seqDB search
MTDARSKIIYTLTDEAPLLATAAFLPVIRTFTQAAGIDVETSDISVAARILGEFSDLLPP
EQRVTNNLAELGKLTLNPKANIIKLPNISASVGQLTAAIKELQGKGYALPDYPDAPKNDE
EKAIKARYSKCIGSAVNPVLREGNSDRRAPRAVKEFARKNPHSMAEWSQASRSHVSHMHA
GDFYHGEKSMTLDRPRDVKMELITKSGKTIILKPKVSLLDREVIDSMFMSKKALLEFYEK
EIEDAHNTGVMFSLHVKATMMKVSHPIVFGHCVKIFYKDAFAKHGDLFKELGVNVNNGMA
DLYNKIATLPQSKQDEIKRDLHACHEGRPELAMVDSAKGITNFHSPNDVIVDASMPAMIR
NGGKMWGADGRLKDVKAVMPESTFARIYQEMINFCKWHGAFDPKTMGTVPNVGLMAQQAE
EYGSHDKTFEIPEDGVANITDLNTGEVLLSQNVEEGDIWRMCQVKDAAIRDWVKLAVTRA
RNSGMPVVFWLDQYRPHEAQLITKVKMYLHEHNTAGLEIQIMSQVRAMRYTLERVIRGLD
TISATGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEEN
HLRWDSLGEFLALAVSLEDLGIKTSNNQSKILAKTLDAATGKLLDNNKNPSPKTGQLDNR
GSQFYLAMYWAQELAAQTEDLALQAKFTPLAKLLTDKEKTIVAELNAVQGHPVDIGGYYY
PSPEKLKAIMCPSATFNAALASAA
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgcccgctccaaaatcatttacaccctcacggatgaagcccccctcttggcc
actgcggcttttttgcctgtcattcgcacattcacacaagccgctggcattgacgttgaa
accagcgacatctccgtggccgctcgcatcctgggtgaattctctgatctgctgccaccc
gagcaacgcgtgaccaacaacttggccgaactgggcaagctcacgctcaaccccaaagcc
aacatcatcaagctgcccaacatcagcgcctcggtgggtcaattgactgccgccatcaaa
gaattgcaaggcaagggctatgccctgcccgattaccccgatgcacctaaaaatgacgag
gaaaaagccatcaaggcccgttattccaagtgcattggctcggccgtgaacccggtgctg
cgcgaaggcaactctgatcgacgtgcccctcgcgccgtcaaagagttcgcccgcaaaaac
ccccacagcatggccgaatggagccaggcttcccgctcgcacgtctcgcacatgcatgca
ggcgacttctaccatggcgaaaagtccatgacgctggaccgtccccgtgacgtgaagatg
gagctcatcaccaagagcggcaaaaccatcattctcaagcccaaagtctctttgcttgac
cgtgaagtgatcgacagcatgttcatgagcaaaaaagctttgctcgagttctatgaaaaa
gagattgaggacgcgcataacacgggcgtgatgttctcgctgcacgtcaaggccaccatg
atgaaggtctcgcaccccatcgtctttggtcactgtgtcaagattttttacaaagacgca
ttcgccaaacatggcgacttgttcaaagagttgggcgtgaacgtcaacaatggcatggcc
gatctctacaacaagattgccaccctgccccagtccaaacaagacgaaataaagcgtgac
ttgcacgcttgccacgaaggccgccctgagctggccatggtggactcagccaagggcatc
accaacttccactcgcccaacgacgtgatcgtggacgcctccatgcccgccatgatccgc
aatggcggcaagatgtggggcgccgatggccgtttgaaagacgtcaaggccgtgatgccc
gagtcgaccttcgcccgcatctaccaagagatgatcaacttctgcaagtggcacggcgcc
ttcgaccccaagaccatgggcaccgtgcccaacgtgggtctgatggcccaacaggctgag
gagtacggctcgcacgacaaaaccttcgagattcccgaagacggcgtggccaacatcacc
gacctcaacacgggtgaagtgctgctgagccaaaacgtggaagaaggcgacatctggcgc
atgtgccaggtcaaggacgctgccatccgcgactgggtcaaactggccgtgacgcgtgca
cgcaactccggcatgcctgtggtgttctggcttgaccagtaccgtccccacgaagcccaa
ctgatcaccaaggtgaagatgtacctgcacgagcacaacacggcaggtctggaaatccag
atcatgagccaagtgcgtgcgatgcgttacaccttggagcgcgtgatccgcggcttggac
accatcagcgccacgggcaacatcctgcgcgactacctgaccgacctgttccccatcatg
gaactgggcacctcggccaagatgctgtccatcgtgcctttgatggctggtggtggcatg
tacgaaaccggtgcgggtggctccgcccccaaacacgtccaacagttggtcgaggaaaac
catctgcgttgggactcgctgggtgaattcctggccctggctgtgtcactggaagacttg
ggcatcaaaacgagcaacaaccagtcgaaaatcctggccaaaacactcgatgcagccaca
ggcaaattgctcgacaacaacaagaacccttcccccaaaacaggtcaattggacaaccgt
ggcagccagttttatctggcgatgtactgggcgcaggaattggcagcgcaaaccgaggat
ctggccttgcaagccaagttcacgcctttggcgaaactcttgaccgacaaggaaaagacc
atcgtggccgaactcaatgcagtgcaaggacatccggtggacattggcggttattactat
ccttcacccgaaaagctcaaggccatcatgtgccctagcgcgaccttcaacgcagctttg
gcctctgcagcctga

DBGET integrated database retrieval system