KEGG   Limnohabitans sp. 63ED37-2: L63ED372_01548Help
Entry
L63ED372_01548    CDS       T04121                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
lih  Limnohabitans sp. 63ED37-2
Pathway
lih00061  Fatty acid biosynthesis
lih00780  Biotin metabolism
lih01100  Metabolic pathways
lih01212  Fatty acid metabolism
Module
lih_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:lih00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    L63ED372_01548 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    L63ED372_01548 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lih01004]
    L63ED372_01548 (fabZ)
Enzymes [BR:lih01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     L63ED372_01548 (fabZ)
Lipid biosynthesis proteins [BR:lih01004]
 Fatty acid synthase
  Component type
   L63ED372_01548 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: ALK88756
UniProt: A0A0P0M914
LinkDB All DBs
Position
complement(1624461..1624907)
Genome map
AA seq 148 aa AA seqDB search
MMDIHKILKQLPHRYPILLVDRVLELEKGVRIKALKNVSINEPHFQGHFPHRPVMPGVLM
LEALAQAAALLAFDTLGETPDDQTVYYFAGIDGARFKRPVEPGDQLILEVELDRMKAGIF
KFKARAKVGDEIATEAELMCTMRKIPQA
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgatggacatccacaaaattctcaaacagctgccgcaccgctaccccattttgctggtg
gaccgcgtgctcgaactcgaaaaaggcgttcgcatcaaagcgctaaaaaacgtgtcgatc
aatgagccccatttccagggtcactttccccaccgtcctgtgatgccgggtgtgttgatg
ctggaagccctggcccaagccgcagccttgctggcctttgacaccttgggtgagacaccc
gatgaccagactgtgtattactttgccggcatcgacggcgcccgattcaaacgcccggtg
gagcccggtgatcagctcatcttggaagttgagctcgaccggatgaaagccggcattttc
aagttcaaggcacgcgccaaggtgggcgatgagatcgcgaccgaggccgagttgatgtgc
accatgcggaaaattcctcaggcttga

DBGET integrated database retrieval system