KEGG   Limnohabitans sp. 63ED37-2: L63ED372_02842Help
Entry
L63ED372_02842    CDS       T04121                                 

Gene name
tufA_1
Definition
(GenBank) Elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
lih  Limnohabitans sp. 63ED37-2
Brite
KEGG Orthology (KO) [BR:lih00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:lih03012]
    L63ED372_02842 (tufA_1)
   03029 Mitochondrial biogenesis [BR:lih03029]
    L63ED372_02842 (tufA_1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lih04147]
    L63ED372_02842 (tufA_1)
Translation factors [BR:lih03012]
 Eukaryotic Type
  Elongation factors
   L63ED372_02842 (tufA_1)
 Prokaryotic Type
   L63ED372_02842 (tufA_1)
Mitochondrial biogenesis [BR:lih03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    L63ED372_02842 (tufA_1)
Exosome [BR:lih04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   L63ED372_02842 (tufA_1)
  Exosomal proteins of breast cancer cells
   L63ED372_02842 (tufA_1)
  Exosomal proteins of colorectal cancer cells
   L63ED372_02842 (tufA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 Lsm_C RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ALK90040
UniProt: A0A0N7J954
LinkDB All DBs
Position
complement(2973201..2974391)
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAAKFGGAAKAYDQIDAAPEEKARG
ITINTAHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIVQGSAKLALE
GDKGPLGEQAIMKLAEALDTYIPTPDRAVDGAFLMPVEDVFSISGRGTVVTGRIERGIVK
VGEEIEIVGIKDTVKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLCKPGS
IKPHTHFTGEIYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGAIELPEGKEMVMPGDNVS
ITVKLINPIAMEEGLRFAIREGGRTVGAGVVAKIIA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggaaaaattcgaacggaccaaaccccacgtgaacgtgggcaccatcggtcac
gttgaccacggcaaaaccaccctgactgctgccatcaccaccgtgttggctgccaagttc
ggcggtgctgccaaagcgtacgaccagatcgacgcggcgcccgaagagaaggcccgtggt
atcacgatcaacaccgcgcacgttgagtacgaaacagaaaatcgtcactacgcacacgtg
gactgccctggccacgctgactatgtgaagaacatgatcaccggtgctgcccagatggac
ggtgcgattttggtttgctccgctgctgacggccctatgcctcagacccgtgaacacatc
ctgttggcccgccaggtgggcgtgccttacatcatcgtgttcctgaacaagtgcgacatg
gttgacgacgctgagttgttggaactggtcgagatggaagtgcgcgagttgttgtccaag
tacgacttcccaggcgacgatacaccgatcgtgcaaggttccgccaagctggcactggaa
ggcgacaagggtcctctgggcgagcaagccatcatgaagctggccgaagctttggacact
tacatccctacgcctgaccgcgcagtggacggcgcattcctgatgcccgtggaagacgtg
ttctccatctctggccgtggcaccgtggtgaccggccgtatcgagcgcggtatcgtcaaa
gtcggcgaagaaatcgaaatcgtgggtatcaaagacacggtcaagaccacttgcacaggc
gttgagatgttccgcaagctgctggaccaaggtcaagctggcgacaacgtcggtatcttg
ctgcgcggcaccaagcgcgaagacgtcgagcgcggccaagtgctgtgcaagcccggctcg
atcaagccgcacacccacttcacgggcgagatctatgtcttgtccaaagacgaaggtggc
cgtcacacgcctttcttcaacaactaccgtccccagttctacttccgtacgactgacgtg
accggcgcgatcgagttgccagaaggcaaagagatggtgatgcctggtgacaacgtgtcg
atcactgtgaagttgatcaaccccattgcgatggaagaaggcttgcgcttcgccatccgc
gaaggcggccgcacggttggcgctggcgtggttgccaagatcatcgcttaa

DBGET integrated database retrieval system