KEGG   Limnohabitans sp. 63ED37-2: L63ED372_02846Help
Entry
L63ED372_02846    CDS       T04121                                 

Gene name
dacC_1
Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase DacC precursor
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
lih  Limnohabitans sp. 63ED37-2
Pathway
lih00550  Peptidoglycan biosynthesis
lih01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lih00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    L63ED372_02846 (dacC_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lih01002]
    L63ED372_02846 (dacC_1)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lih01011]
    L63ED372_02846 (dacC_1)
Enzymes [BR:lih01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     L63ED372_02846 (dacC_1)
Peptidases [BR:lih01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   L63ED372_02846 (dacC_1)
Peptidoglycan biosynthesis and degradation proteins [BR:lih01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   L63ED372_02846 (dacC_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: ALK90044
UniProt: A0A0P0MBF7
LinkDB All DBs
Position
complement(2977963..2979135)
Genome map
AA seq 390 aa AA seqDB search
MTDKRMNTFLKFLLGACLSATFWGAQAQMPQAPEIAAKAYLLMDVTANQVLAAKDPDMAV
EPASLTKLMTAYLVFDALKNRKIDIKQTLPVSERAWKMPGSRMFIDPKMKVPVEDLIKGM
IVQSGNDATVALAEGVAGSVERFVQLMNDQAVFLGMHNTQYKNPEGLTAPGHSTTARDLA
LLATRLMRDFPDYVPYYAIKKYRYEGTPAANDTNRNLLLFRDASVDGLKTGHTQAAGYCL
VASAKRELPNVGTRRLLSVVLGADSENARANESQKLLNWGYSAFDAVKLFDANQAVVTPP
VWKGKQPVLKLGSVRPLVVAVPAGSAAQLKTQVVRPDPLVAPFTKGQAVGSLKVMQGDKA
LFEVPLLVLEPVEQSGVLGRAWDAVRLWIK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgacagacaagcgcatgaacacatttttgaaatttttgctgggagcttgcctttccgcc
accttttggggtgcccaggcccagatgccacaagcgccggagatcgcagccaaagcttat
ttgctgatggatgtgacggccaaccaagtgctcgcggccaaagaccccgatatggcggta
gagccggcctcgctcaccaagctgatgacggcctatttggtctttgacgccctgaaaaac
cgcaaaatcgacatcaagcagaccttgccggtgtccgagcgcgcctggaagatgccagga
tcgcgcatgttcatcgatcccaagatgaaggtgcccgtggaggacttgatcaagggcatg
attgtccaatcgggcaacgacgcgaccgtggccttggccgaaggggtggcgggcagtgtc
gagcgctttgtgcagctgatgaacgaccaggcggtctttttgggcatgcacaacacacag
tacaaaaatccggaaggcttgacggctccaggtcactccaccaccgcccgtgacttggcc
ctgctggccacacgcctgatgcgcgacttcccagattacgtgccttattacgccatcaaa
aaataccgctacgaagggactccggcggccaatgacaccaaccgcaacctgttgttgttt
cgcgacgccagtgtggacgggctcaaaaccggccacacccaggctgcgggttactgcctg
gtggcctcggccaagcgagagctgcccaatgtggggacgcgccgcttgctgagtgtggtg
ttgggggccgacagtgaaaatgcccgggccaacgagagccagaagttgctgaactggggt
tattcggcgtttgatgcagtgaaactttttgatgccaaccaggccgtggtcacgccacct
gtgtggaaaggcaaacagccggtgctcaaactcggttcggtgcgacctttggtggtggcg
gttcccgcaggcagcgcggcgcaactcaaaacccaggtggtgcgcccagaccccttggtg
gcgccgttcaccaaaggccaggcagtcgggagcctgaaggtgatgcagggcgacaaagcc
ttgtttgaggtgcctttgctggtgctggagccggtggagcaatccggcgtgctgggccgt
gcctgggatgctgtgcggctgtggatcaagtga

DBGET integrated database retrieval system