KEGG   Listeria ivanovii subsp. ivanovii WSLC 3010: JL52_01920Help
Entry
JL52_01920        CDS       T03400                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
lii  Listeria ivanovii subsp. ivanovii WSLC 3010
Pathway
lii03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:lii00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    JL52_01920
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lii03400]
    JL52_01920
Enzymes [BR:lii01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     JL52_01920
DNA repair and recombination proteins [BR:lii03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     JL52_01920
 Prokaryotic type
     JL52_01920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AIS64385
LinkDB All DBs
Position
407895..408557
Genome map
AA seq 220 aa AA seqDB search
MVKTWDEFLKQEAIKPYFIDLMKEVANARAKGNVYPSEEDMFSCFRLCPYDKVKVVILGQ
DPYHGPGQAHGLSFSVQKGVRIPPSLRNIYKELKTDLDIEPADHGHLAKWAEQGVLLMNT
SWSVEEGKAGSHKKLGWTTFTDHVLEELNNYEKPLVFILWGNHAIKAASGITNPNHLLIE
GVHPSPLAASRGFFGSKPFSKTNDFLEKAGRTPINWDLTE
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaacttgggatgaatttctgaagcaagaagctatcaaaccatattttattgat
ttaatgaaggaagtcgcgaatgctagagcaaaagggaacgtctatccatcagaagaagac
atgttctcctgtttccgcttatgtccatatgataaagttaaagtcgtcattcttggccaa
gatccataccacggaccaggacaagcgcacggacttagcttctccgtccaaaaaggcgtg
cggattccaccaagcctcagaaacatctacaaagaattaaaaaccgacctagatatcgaa
ccagctgaccacgggcatcttgctaaatgggccgaacaaggcgtgctgctgatgaacact
agttggagcgtggaagaaggtaaagcagggagccacaaaaaattaggctggacgacattt
accgaccatgtacttgaagaattaaacaactatgaaaagccattagtatttattctatgg
ggaaatcatgctattaaagccgcaagtggaatcactaatccaaaccatttactaattgaa
ggcgttcacccatctccactcgcagcaagtcgcggatttttcggaagtaaaccgttttca
aaaacaaatgatttcctagaaaaggctggaagaaccccgattaattgggatttaactgaa
taa

DBGET integrated database retrieval system