KEGG   Listeria ivanovii subsp. ivanovii WSLC 3010: JL52_11205Help
Entry
JL52_11205        CDS       T03400                                 

Definition
(GenBank) sodium ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
lii  Listeria ivanovii subsp. ivanovii WSLC 3010
Brite
KEGG Orthology (KO) [BR:lii00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lii02000]
    JL52_11205
Transporters [BR:lii02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    JL52_11205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran DUF4162 AAA_21 AAA_15 AAA_22 RsgA_GTPase AAA_29 SbcCD_C TsaE Zeta_toxin AAA_30 AAA_19 AAA_23
Motif
Other DBs
NCBI-ProteinID: AIS66074
LinkDB All DBs
Position
2299130..2300026
Genome map
AA seq 298 aa AA seqDB search
MTLELHNVTKKFADKTAVNDLSFRVEEGKILGLIGQNGAGKTTTFRLILHFLEATSGKIT
WNGKEVSKIDPNIVGYLPEERGLYPNVTIEEQLIFFAELKGYPKQKIKNEIDDWLERAEV
VGKKTDLIKTLSKGNQQKIQLLSTIIHQPKLVILDEPFSGLDPVNAEILKKFVFDLRASG
AAIIFSSHRMENVEELCDSLLMLKKGSTVLQGTTESVKSVFGRKRIFIESGHTKEQLAAL
PGVLHIKTQRNGVFQLKIANESDAEKIFDYVTKDGFIQTFSLQAPTLEEIFKWKAGEF
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcttgaactacataatgttacaaaaaaatttgctgataaaacagctgtgaatgac
ttgtcttttcgagtagaagaagggaaaatacttggactcattggacaaaatggtgctgga
aaaacgactacttttcgcctgattttgcattttttagaggccacttctggaaaaatcaca
tggaatggcaaagaagtaagtaaaatcgacccgaatatcgtcggctatttgccagaggaa
cgtggtttgtatccaaatgtcaccatcgaagagcaactgatattttttgcagaactaaaa
gggtatcctaagcaaaaaataaaaaatgagatagatgattggttagaacgtgccgaggtt
gttggtaaaaagacagatttaattaagacgttatccaaaggaaaccaacaaaaaatccag
cttttaagtacgattattcatcaaccaaaactagttattttagatgaaccttttagtggt
cttgatcctgtgaatgctgaaattttgaaaaagtttgtttttgatttacgtgcttctgga
gctgctattattttctccagccaccgtatggaaaatgtcgaggaactatgtgattcgctt
ctaatgttaaaaaaaggcagtacggtgcttcaaggaacaactgaatccgttaaatctgtc
tttggtcgtaaacgaattttcattgaatcaggtcatacaaaagaacaactagctgcattg
cctggagtacttcatatcaaaactcaacgcaatggtgttttccagctgaaaatagccaat
gaatctgatgccgagaaaattttcgattatgtcacaaaagatggattcatccaaacattc
agcctccaagctccaacactcgaagaaatctttaaatggaaagctggtgaattctaa

DBGET integrated database retrieval system