KEGG   Listeria ivanovii subsp. ivanovii WSLC 3010: JL52_12360Help
Entry
JL52_12360        CDS       T03400                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lii  Listeria ivanovii subsp. ivanovii WSLC 3010
Pathway
lii00250  Alanine, aspartate and glutamate metabolism
lii00410  beta-Alanine metabolism
lii00430  Taurine and hypotaurine metabolism
lii00650  Butanoate metabolism
lii01100  Metabolic pathways
lii01110  Biosynthesis of secondary metabolites
lii01120  Microbial metabolism in diverse environments
lii02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lii00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    JL52_12360
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    JL52_12360
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    JL52_12360
   00430 Taurine and hypotaurine metabolism
    JL52_12360
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    JL52_12360
Enzymes [BR:lii01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     JL52_12360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AIS66281
LinkDB All DBs
Position
complement(2524793..2526196)
Genome map
AA seq 467 aa AA seqDB search
MLYSENDKRKHESYRIPLFGSEEESTSIPKYVLKKEPMEPRIAYQLVKDQLMDEGNARQN
LATFCQTYMEEEAQLLMAETLEKNAIDKSEYPQTAELENRCVNILADLWNAPKEMAYLGT
STVGSSEACMLGGLAMKFRWRKNAEKRGLDIQAKRPNLIISSGYQVCWEKFCVYWDIDMR
VIPMDKEHLSLDVDRVFDFVDDYTIGIVGILGITYTGKFDDIALLDEKVEAYNEANEHQL
VIHVDGASGAMFTPFVNPELPWDFRLKNVVSINTSGHKYGLVYPGVGWILWKDKEYLPEE
LIFEVSYLGGSMPTMAINFSRSASQIIGQYYNFLRFGFEGYREIHEKTKKTALYLAKTVE
KSGYFEIINDGSNLPIVCYKMKEDLDVEWTLYDLADQLLMKGWQVPAYPLPTDLSDTIIQ
RFVCRADLGHNVAEEFASDFHAAIKNLEHARVLYHDKGRNDSYGFTH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgctttatagcgaaaacgacaagcgaaaacatgaaagttatcgaattccactctttggt
tccgaggaagagagtacaagtattccgaaatatgttttgaagaaagaaccaatggaaccg
cgtattgcttatcaactcgtgaaagatcagttgatggatgagggaaatgctagacaaaac
ttggcgactttttgtcaaacatacatggaagaagaagcgcagttacttatggcggaaacg
ctcgaaaaaaatgcgatagataagtcggaatatccgcaaaccgcagaactcgaaaacagg
tgtgttaatattttagctgatttatggaatgcgccgaaagaaatggcttacttaggcact
tccactgtcggatcatccgaggcatgcatgctcggtggtttagcaatgaaatttagatgg
cgtaaaaatgctgaaaaacgtgggttagatattcaagcaaaacgtcctaatttgattatt
tcttcagggtatcaagtttgttgggaaaaattttgtgtgtactgggatatcgatatgcgt
gtgataccaatggataaagaacatctaagtttagacgtggaccgggtatttgattttgta
gatgattatacgattggtattgttgggattttaggtattacttatactgggaaatttgat
gatattgctttactagatgaaaaagtagaggcttataatgaagccaatgaacatcaacta
gtgattcatgtggacggagcgagtggtgcgatgtttacaccctttgtaaatccagaattg
ccatgggacttccgtttgaaaaacgtcgtttcaattaatacatctggtcataaatatggt
ctcgtttatccaggcgttggatggatactttggaaggataaagagtatttaccagaagaa
ttaatttttgaagtaagttacttgggtggttcgatgccaacgatggcgattaatttctcc
agaagtgctagccaaattatcgggcaatattataattttttacggtttggttttgaaggt
taccgagaaattcacgaaaaaacaaagaaaacagcactctatcttgcaaaaacagtagaa
aaaagtggctattttgagattatcaatgatggttctaacttgccgatagtttgttataaa
atgaaagaagatttggatgtcgaatggacattgtatgacttagcagatcaacttttaatg
aaaggctggcaagttcctgcgtacccactaccaactgatttgagtgatacaataattcaa
cgttttgtttgccgggcagatttagggcataatgttgccgaagaatttgcgagtgatttt
catgcggcaatcaagaatttagaacatgcgagagtactctatcatgataaaggacgaaat
gattcatacggatttacacattaa

DBGET integrated database retrieval system