KEGG   Leptospira interrogans serovar Lai 56601: LA_1533Help
Entry
LA_1533           CDS       T00098                                 

Definition
(RefSeq) thymidylate synthase
Organism
lil  Leptospira interrogans serovar Lai 56601
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thy1 TH1
Motif
Other DBs
NCBI-GeneID: 1150876
NCBI-ProteinID: NP_711714
UniProt: Q8F5Y2
LinkDB All DBs
Position
I:complement(1532130..1533704)
Genome map
AA seq 524 aa AA seqDB search
MPAQKPIVSLLDHSKDPFNLSIATARTCYSSKGILLPSDMITSEKSIEIRDKVAKSTKKA
GHLTTRQHPQFIFTLDKVSRQFVWSFLHSHPFYNSEQVSQRYVEVKKENYYIPPELDGKL
LELYLDAVDFASQSYFSYTEALHPFIQEEYFQIYKARANYPDKWQTPIKKKCLEVARYLL
PLGTFTYLYHSVNGLTLHRYYRLMNSYDVPNEQRAVITEMINQVRAIDPLYADEMDDPVP
LEETTEYRYFDSMFGNGKREFHPETASTFVKEFDLELGERYSKLVSHSSNGPEILAQSVR
SILGIPKSILNDQDAIDLVLNPAKNRHLTSTLNESSMSPITRALFNVQYSFQKRISHTAD
SQDQRHRMVPGGRPVLMSQYAGIPDYITPFVVQKYPELKEKYDVVHREIFEKLNRFLEAG
GSPEHGTYLLPNSFPIRFYESGDLLNLHHKWRSRTCYNAQEEIFQASVDELTDVMKVHPQ
IAKWIKAPCWIRLQGEVKPYCPEGDHYCGTQVWKRELSEYSRVI
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgccagcccaaaaaccaatcgtttcacttctagatcatagtaaagatccattcaatcta
tctatagccactgcaagaacctgttattcttctaaaggtatccttcttccttccgatatg
atcacttcggaaaagtcgatagagatccgagataaagtcgccaaatccactaaaaaagcg
ggacatcttaccactcgtcaacatccacagtttatatttacgttggacaaagtatccaga
caattcgtttggtcttttctacattcacatccattttataattccgaacaagtttctcaa
agatacgtggaagtaaaaaaagagaattactacatcccacccgaactcgacggaaaactt
ttagaactttatttagatgccgtagactttgcaagtcagtcttacttttcttacacggaa
gcgttacatccttttatccaagaagaatactttcagatttataaggcccgtgccaactat
ccagacaagtggcaaactccaatcaaaaagaaatgtttggaagtagcacgttatctgcta
cctctaggaacatttacatatctatatcactccgttaacggacttactctacatcgttac
tatagattgatgaattcctacgacgttccaaacgaacaaagagccgttattacggaaatg
atcaatcaagttcgagcaatcgatcctttatacgccgacgaaatggacgatccggttcct
ctcgaagaaaccacagaatatcgttatttcgactccatgtttggaaatggtaagagagaa
tttcatccggaaaccgcttctacttttgtaaaagaatttgatttggagttaggagaaaga
tattctaaactagtctctcattcttccaacggccctgaaattttagctcaatcggttcgc
tctatattaggaattcctaaatcaattcttaacgaccaagacgcaattgatttggtttta
aatcccgcaaagaacagacatcttacttctactttgaatgaaagttccatgagtccgatt
acaagggcgctttttaacgttcagtattcttttcaaaaaagaatctcccatactgcagac
agtcaagatcaaagacatagaatggttcctggaggaagacctgttttaatgtctcaatat
gcgggtattcctgattatataaccccttttgtagttcaaaaatatcctgaactcaaagaa
aaatacgacgtagttcatagagaaatttttgaaaaactaaatcgttttttagaagcggga
ggttcccccgaacacggaacgtatcttttgccgaatagttttccaattcgtttttacgaa
agtggagacctactcaaccttcatcataaatggagatctagaacttgttataacgctcag
gaagaaatttttcaagcctcagtagatgaattgacggacgtaatgaaagtccaccctcag
atagcaaaatggatcaaagcaccttgttggatacgtttacaaggagaagtcaaaccttat
tgtccagaaggagatcactactgtggaactcaggtttggaaaagagagttgtccgaatat
tccagagtgatttag

DBGET integrated database retrieval system