KEGG   Leptospira interrogans serovar Lai 56601: LA_2236Help
Entry
LA_2236           CDS       T00098                                 

Gene name
glpA
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
lil00564  Glycerophospholipid metabolism
lil01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lil00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LA_2236 (glpA)
Enzymes [BR:lil01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     LA_2236 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 GIDA Pyr_redox_2 NAD_binding_8 Thi4 FAD_binding_3 HI0933_like 3HCDH_N Pyr_redox
Motif
Other DBs
NCBI-GeneID: 1151579
NCBI-ProteinID: NP_712417
UniProt: Q8F412
LinkDB All DBs
Position
I:complement(2215173..2216825)
Genome map
AA seq 550 aa AA seqDB search
MQICRGKETCKAGRVLKMEKQKRVDQISKLQKESFDILVIGGGSTGAGAAFDAAKRGYKT
ALIERKDFASGTSSRSTKLIHGGVRYLAQFHFKLIHEALTERQRLLENAPHLVKPLKFVL
PAYRFYERPYYGIGLTLYDILASKGKLPSHKTVSKSETISEFKAIKRDGLFGGITYYDAQ
FNDARLNVLLARSAQKEGAVVANRIELVSFIKKSGKIVGANLKDLETAKTFPVYTKVIAN
TTGIWVDHIRKLDDPRTFNVLSPSQGIHLVFSKERVPCTSAMIIPKTKDGRVVFIIPWED
HVILGTTDTPIENPGEEPLPIGNEVQFLLDTGNEYLENPVTEKDILSVFVGIRPLISPEG
NQDTKNISREEVILVSNSGLVTMGGGKWSTYRKMAEDLVDKLIQIGNLEVREKCSTKFYV
YPGAADYSESLYQEIEKTYKIDTIFAKRLQNYYGTEVFEVLGKKPKLLGKGIPYFEEEVL
FAVNEEFALGVTDVLARRFRILFVDLSLAQKMVAPVAMVLSKQLKWKDKTKKAEESAAME
LIESLRKSYR
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatttgtagggggaaagaaacctgtaaagcaggaagagttctcaaaatggaaaaa
caaaaacgagtcgatcaaatttctaaactacaaaaagaatcctttgatattttagtaatc
ggaggtgggtctacaggtgctggagccgctttcgacgcagcaaaaagaggttataaaaca
gctctgattgaaagaaaagattttgcttcgggaacttcttcccgttccaccaaactgatt
catggtggggtccgttatttagctcagttccattttaaattgattcacgaggctttgacg
gaaaggcagaggttattggaaaatgcacctcacttagtcaaacctcttaagttcgtttta
cctgcatatcgattttacgaaagaccgtattacggaatcggtcttactctctatgatatt
cttgcgtctaagggaaaacttccttctcacaaaacggtttctaaatccgaaacaatttcc
gagtttaaagccatcaagagggacggtttatttggtggaattacctattacgacgctcag
tttaatgatgctcgtttgaatgttcttttggcaagatctgcacaaaaagaaggagccgta
gttgccaatcgaatagaactcgtttcttttattaaaaagagcggaaagattgtaggagcc
aatctcaaagatttagagaccgcaaaaacctttccagtttatacaaaggtaatcgcaaat
acaactggaatctgggtagatcacattcgtaagttagacgatccaagaacgtttaacgtg
ctttctcccagccaagggatccacttagtattctccaaagaaagagttccttgtacatcc
gccatgatcattccgaaaacaaaggatgggagagtcgtatttatcattccttgggaagac
cacgtaattcttggaaccacggatactccgattgaaaatccaggagaagaaccacttccg
atcggaaatgaggttcaatttttattggatactggaaacgaatatttggaaaatccagtc
actgaaaaagatattctttccgtgtttgtaggaattcgtcctttgatttcaccagaggga
aatcaggatacgaagaatatttcgagagaggaagtgattttagtttctaattccggtttg
gttacgatgggaggaggaaaatggtccacttacagaaagatggctgaggatttggtggat
aaactcattcagatcggaaatctagaagttagagaaaaatgttctactaaattttatgtt
tatcctggagctgcagattattcagaatctctttaccaggaaattgaaaaaacatataag
atcgatacgatctttgcaaaaaggcttcaaaattattatggaacggaagttttcgaagtt
ttgggaaaaaaaccgaaactattgggaaaaggaattccgtatttcgaagaggaagttttg
tttgcggttaacgaagaatttgcgttaggcgtcacggacgttcttgcaagaagatttaga
attctatttgtagatctcagtttggcgcagaagatggtcgctcctgtggctatggttctt
tccaaacaactcaagtggaaggacaaaacaaaaaaagcggaagaatccgctgcaatggag
ctaatcgaaagtttgaggaagtcgtatcgataa

DBGET integrated database retrieval system