KEGG   Limnohabitans sp. 103DPR2: L103DPR2_00452Help
Entry
L103DPR2_00452    CDS       T04120                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lim  Limnohabitans sp. 103DPR2
Pathway
lim00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:lim00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    L103DPR2_00452
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lim02000]
    L103DPR2_00452
Enzymes [BR:lim01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     L103DPR2_00452
Transporters [BR:lim02000]
 Other Transporters
  Pores ion channels [TC:1]
   L103DPR2_00452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_C_2 GST_N GST_N_2 Tom37
Motif
Other DBs
NCBI-ProteinID: ALK90865
UniProt: A0A0P0MCV0
LinkDB All DBs
Position
complement(483311..483961)
Genome map
AA seq 216 aa AA seqDB search
MLKLCGFGASNYHNKVKLALLEKGVAFEEELVWVGETDPLGSPLGKVPYLKTEHGNLCES
TVMVEYIEQAYPAHPLMPQDPFAAAKVRELMTFLDLHLELLARNLYPEAFFGGKVSDATK
EKIGAQLEKNVAAFATLAQFKPFIAGAEMTLADCTAAVHLPVITAATKTIYGRDFLADLP
VKAYMKMWAERPSMQRVHADRKASNELFMARMTSKP
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaactctgcggctttggcgccagcaactatcacaacaaagttaaattggcgctg
cttgaaaagggcgtggcctttgaagaagagttggtttgggtgggcgaaacagacccattg
ggcagtccgttgggcaaagtgccttatttgaaaacagaacacggcaacctgtgcgaatcg
actgtgatggtggaatacatcgagcaagcctatcccgcccaccccttgatgccccaagac
ccctttgctgctgccaaagtgcgcgagttgatgacgttcttggacttgcacttggaattg
cttgcgcgcaatttgtatccagaggctttctttggcggcaaggtcagcgatgccaccaaa
gaaaaaattggtgcgcagcttgagaaaaacgtggcggcctttgccaccttggcgcagttc
aagcctttcattgccggcgcagaaatgaccttggccgactgcaccgctgctgttcacttg
ccagtgatcacggccgccaccaaaaccatctatggccgtgacttcttggcggacttgccc
gtcaaagcctacatgaagatgtgggcagaaagacccagcatgcaacgcgtgcatgctgat
cgcaaagcaagcaacgagctcttcatggcgcgcatgacaagcaagccctga

DBGET integrated database retrieval system