KEGG   Limnohabitans sp. 103DPR2: L103DPR2_00463Help
Entry
L103DPR2_00463    CDS       T04120                                 

Gene name
glpD
Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lim  Limnohabitans sp. 103DPR2
Pathway
lim00564  Glycerophospholipid metabolism
lim01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lim00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    L103DPR2_00463 (glpD)
Enzymes [BR:lim01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     L103DPR2_00463 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored NAD_binding_8 HI0933_like Pyr_redox_2 Thi4 Pyr_redox_3 FAD_binding_3 Lycopene_cycl GIDA 3HCDH_N Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ALK90876
UniProt: A0A0P0MCR2
LinkDB All DBs
Position
495432..497018
Genome map
AA seq 528 aa AA seqDB search
MKPLKTDRAQLMARLASVDEYDLAIIGGGATGLGTAVDAAVRGLKVVLVEAHDFAKGTSS
RSTKLIHGGVRYLAQGHLPLVWEALHERQTLLRNAPHLAHAMPFVMPAYRRIDQWFYGLG
LKLYDLLAGRAGLGPTQFLNRNETLHKAPGTLATHLVGGVQYWDGQFDDARLALALARTA
AAHGALVINHMPVTGLLTTLGTGKVCGLTCTDAETGFAHHIKARCVVNATGVWVDEIEAM
TQTRVADTTQTRVPHAVSPSQGVHLVVDASFWPGETALLVPRTQDGRVLFAVPWQGKVLL
GTTDTPKSLVEWEPQALDSEIDQILEEAGKYLAKVPTRHDVTSVWAGLRPLAGAQSDAGK
TPSATQNISREHTVKLATNGLISVMGGKWTTYRAMAADVMQCIRKAHLLSLTAEDVTVHT
SLWGAQTPAPDDPLAAYGTDAPLLREMAGHDHWLSPHVSEAMVRFAARYEYARTVEDVLA
RRKRLLFLDAKKAAQIAPEVASLLEAETGGDAQLAAFIALAETYQVRS
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctttgaagacagaccgagcgcaattgatggcgcgcttggccagtgtggatgag
tacgacctggccatcattggcggcggcgccactggcttgggaaccgcggttgatgcggca
gtgcgcggcctcaaggttgtcctggtggaagcccacgactttgccaaaggcacgtcatcg
cggtccaccaaattgattcatggcggtgtgcgttatttggcgcaaggacatttgcccttg
gtctgggaggcgctgcacgagcgccaaacattgttgcgcaacgcgccccatttggcgcat
gccatgccctttgtcatgcccgcttaccgccgcatcgaccaatggttttatggcttgggc
ctcaagctgtacgacctgttggcaggccgcgcgggtttagggcccactcaatttctcaat
cgcaacgaaacattgcacaaagcgccgggcacattggccacgcatttggtggggggcgtg
caatattgggatggccaatttgacgatgcgcgtttggctttggccttggcgcgcacggca
gcggcgcatggtgccttggtcatcaatcacatgcctgtcacgggcttgctcaccaccttg
ggcactggcaaagtgtgcggcctcacatgcaccgatgccgagacgggatttgcgcatcac
atcaaagcgcgttgcgtggtcaacgccacaggcgtatgggtggacgagattgaagccatg
acgcaaacccgtgtggccgacaccacgcaaacccgtgtgccgcatgccgtcagccccagt
cagggcgtgcatttggtcgtcgatgcgtcgttctggcctggtgagacggccctgttggtg
ccgcgcacacaagatggccgcgtgctgtttgccgtgccttggcaaggcaaagttttgttg
ggcaccaccgacacgcccaagtcattggttgaatgggagccgcaagcgctggactctgag
attgaccaaatcttagaagaagctggaaagtacttggccaaggtgcccacgcgacatgat
gtgaccagtgtgtgggctggtttgcggcctttggctggcgcccaatccgatgcaggcaag
acgccaagcgcgacccaaaacatcagccgtgaacacaccgtcaaactggccaccaatggt
ctgatcagcgtgatgggtggcaaatggaccacgtacagggccatggcggccgatgtgatg
cagtgcatccgcaaggcgcacctcttgtctctcacggcggaagatgtcacggtgcatacg
tcgctgtggggtgctcagacgccagcacccgacgaccctctggccgcctatggcacagat
gcgcccctgctccgtgaaatggcgggtcatgaccattggctcagcccccatgtcagtgaa
gccatggttcgctttgctgcgcgctatgaatatgcacgaaccgtggaggacgtcttggcc
aggcgcaagcgcttgttgttcttggacgccaaaaaggctgcccagattgcgccagaggtg
gccagcctgttggaagccgaaacggggggtgacgcgcaattggcggcctttatagccttg
gccgagacctatcaagtgcgctcgtga

DBGET integrated database retrieval system