KEGG   Limnohabitans sp. 103DPR2: L103DPR2_00999Help
Entry
L103DPR2_00999    CDS       T04120                                 

Gene name
chlL
Definition
(GenBank) Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
lim  Limnohabitans sp. 103DPR2
Pathway
lim00860  Porphyrin and chlorophyll metabolism
lim01100  Metabolic pathways
lim01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lim00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    L103DPR2_00999 (chlL)
Enzymes [BR:lim01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     L103DPR2_00999 (chlL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA MeaB AAA_24 MipZ AAA_26 SRP54 CBP_BcsQ AAA_25 AAA_10
Motif
Other DBs
NCBI-ProteinID: ALK91403
UniProt: A0A0P0MF26
LinkDB All DBs
Position
complement(1005520..1006431)
Genome map
AA seq 303 aa AA seqDB search
MIETTSIPVQNIKKSSRLDGEGSVQFQMDPNLKIGTAKVFAVYGKGGIGKSTTSSNLSVA
FSKLGKRVLQIGCDPKHDSTFTLTKKLMPTVIDALETVDFHAEELRLDDFVFKGYNNVMC
VEAGGPPAGTGCGGYVVGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHADRAL
IVTANDFDSIFAMNRIVQAIGAKAKNYNVRLGGVIANRSDATDQIDKYNAVVGLKTMAHF
PMLDEIRKSRLMKSTLFELEPTPAVKAVQDEYMRLAAALWLGSDPLPAVPMKDRDIFDLL
GFD
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaacgaccagcatcccagtacagaacatcaaaaagagttcacgactcgacggt
gagggcagcgttcagtttcaaatggaccccaacctcaaaattggcacggccaaagtgttt
gccgtttacggcaaaggcggtattggcaagagcaccacatcgtccaacttgtcggtggct
ttcagcaaattgggcaaacgtgttttgcaaattggctgcgatcccaaacacgactccacc
ttcacgttgaccaaaaaattgatgcccacagtcatcgatgctttggaaaccgtcgacttt
cacgcagaagaactgcgcctcgatgactttgtcttcaagggctacaacaacgtgatgtgt
gtcgaagcgggcggcccgcctgccggcacaggctgcggcggttatgtcgtgggtcaaacc
gtcaagctactcaaagagcatcacttgctcgaagacaccgatgtggtgatttttgatgtg
ttgggcgacgtggtgtgcggcggctttgcagcccccttgcaacacgcagaccgcgccttg
attgtcacggccaacgactttgactccatttttgccatgaaccgcattgttcaagccatt
ggtgccaaagccaaaaactacaacgtgcgtttgggcggcgtgattgccaaccgcagcgat
gccaccgaccaaattgacaagtacaacgccgtagtgggtttgaagaccatggctcacttc
cccatgttggacgagattcgcaagagccgtttgatgaagagcacgctgtttgaactggag
ccaacacccgcagtgaaggctgtacaagacgaatacatgcgcttggctgccgccttgtgg
ctgggcagcgaccctttgcctgcggtgcccatgaaagaccgcgatatttttgacttgctc
ggttttgattga

DBGET integrated database retrieval system