KEGG   Limnohabitans sp. 103DPR2: L103DPR2_01246Help
Entry
L103DPR2_01246    CDS       T04120                                 

Gene name
glnQ_2
Definition
(GenBank) Glutamine transport ATP-binding protein GlnQ
  KO
K06857  tungstate transport system ATP-binding protein [EC:7.3.2.6]
Organism
lim  Limnohabitans sp. 103DPR2
Pathway
lim02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:lim00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    L103DPR2_01246 (glnQ_2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lim02000]
    L103DPR2_01246 (glnQ_2)
Enzymes [BR:lim01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.6  ABC-type tungstate transporter
     L103DPR2_01246 (glnQ_2)
Transporters [BR:lim02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Tungstate transporter
    L103DPR2_01246 (glnQ_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 AAA_15 SMC_N DUF87 AAA_16 FtsK_SpoIIIE AAA_22 AAA DUF3584 RsgA_GTPase AAA_23 AAA_28 DUF815 SbcCD_C NACHT AAA_30 G-alpha AAA_25 MMR_HSR1 AAA_33 Mg_chelatase DLIC AAA_13
Motif
Other DBs
NCBI-ProteinID: ALK91648
UniProt: A0A0N7J9Q5
LinkDB All DBs
Position
1254129..1254851
Genome map
AA seq 240 aa AA seqDB search
MTSLIAIQHVSLKLGHVQALSDVSLRIDAGEHVALIGANGSGKSTLLRVLNGLHQVTEGK
LQLATCRQAMLFQRPHMLRMSSWSNVALGLWLDRSLGLPWHQAKARALDALSVVGLSGVK
LQNAATLSGGQQQRLALARAWAKAPELLFLDEPTASLDPPAKREIEALVQRMIAPKDKPS
PMTLIFASHNLGQVKRWASRVIYIEQGRILADLPTADFFNAECLKQHSYQAYLFLQGETS
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgacttccctaattgcaattcagcatgtgagcctgaaactcggccatgtgcaagccctt
agcgatgtgagtttgcgcattgatgcgggtgagcatgtggcgctgattggcgccaacggg
tcaggcaaaagtacgttgctgcgcgttttgaatggcttgcatcaagtcacggagggcaag
ttgcaattggcgacatgccgtcaagccatgctgttccaaagacctcacatgttgcgcatg
agcagttggagcaatgtggccttgggcttgtggttagatcgcagtttgggtttgccttgg
catcaagccaaagcgcgtgcgctggatgctttgtctgtggtgggtttgtccggtgtgaag
ttgcaaaacgcggccaccttgtcgggcggtcagcagcagcgtttggccttggccagagct
tgggccaaagcgcccgaattgcttttcttggacgaaccgacagccagcttggatccacct
gctaaacgagaaattgaagccctggtgcagcgcatgattgcgcccaaggacaaaccaagt
ccgatgactttgatttttgcaagtcacaacttgggtcaagtcaagcgttgggcgagtcgg
gtgatttacatcgaacaaggccgcatcttggcggatttgcccacagcagattttttcaat
gccgagtgtttgaaacaacacagctatcaagcatatttatttcttcaaggagagacttca
tga

DBGET integrated database retrieval system