KEGG   Limnohabitans sp. 103DPR2: L103DPR2_01846Help
Entry
L103DPR2_01846    CDS       T04120                                 

Gene name
sucB
Definition
(GenBank) Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lim  Limnohabitans sp. 103DPR2
Pathway
lim00020  Citrate cycle (TCA cycle)
lim00310  Lysine degradation
lim00380  Tryptophan metabolism
lim01100  Metabolic pathways
lim01110  Biosynthesis of secondary metabolites
lim01120  Microbial metabolism in diverse environments
lim01130  Biosynthesis of antibiotics
lim01200  Carbon metabolism
Module
lim_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lim_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    L103DPR2_01846 (sucB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    L103DPR2_01846 (sucB)
   00380 Tryptophan metabolism
    L103DPR2_01846 (sucB)
Enzymes [BR:lim01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     L103DPR2_01846 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ALK92244
UniProt: A0A0P0MGG9
LinkDB All DBs
Position
complement(1902550..1903803)
Genome map
AA seq 417 aa AA seqDB search
MAIVEVKVPQLSESVAEATMLQWKKKVGDSVAADEILIEIETDKVVLEVPAPSAGVLSEI
LVGDGGTVTAEQLIARIDTDGKVAAAAPAAAAAPAPAASAPAAAPAAQSTSMAGVAMPAA
AKLMADNNLAAGSVAGSGKDGRVTKGDVLSAVAGGAKPAAQVSIPTGVPTSSLPQVAAPA
VNLGDRPEQRVPMTRLRARVAERLLQSQSTNAILTTFNEINMAPVMEMRKRFQDKFEKEH
GIKLGFMSFFVKAAVHALKKFPVLNASVDGNDIVYHGYFDIGIAVGSPRGLVVPILRNAD
QMSFADIEKKIAEFGAKAKDGKLGIEDMTGGTFSISNGGTFGSMMSTPIINPPQSAILGV
HATKDRAMVENGQVVVRPMNYFAMSYDHRIIDGREAVLGLVAMKEALEDPSRLLFDI
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagttaaagttccgcagttgtctgagtccgtggctgaagccaccatg
ctgcaatggaaaaagaaagtgggcgacagtgttgctgccgacgaaattttgatcgagatt
gaaaccgacaaagtggtgttggaagtgcctgcaccttctgcgggtgttttgtctgaaatc
ttggtgggcgacggcggtaccgtcaccgctgagcaactcattgcacgcattgatacagac
ggcaaagtggctgccgcagcacctgccgccgccgctgcgccagcacctgccgccagcgca
cctgctgcagcacccgctgctcaaagcaccagcatggcgggtgtggcaatgcctgccgca
gccaagctgatggccgacaacaacttggccgctggctctgttgctggttctggcaaagat
ggccgcgtcaccaagggtgatgtgttgtccgcagttgccggtggtgctaaacctgctgcg
caagtgtctattccaactggcgtgcccacatcgtcattgccacaagtggcggcacctgca
gtcaacttgggtgatcgcccagagcagcgcgtgcccatgacacgtttgcgtgcccgtgtg
gccgagcgtttgttgcaatcgcaatcgaccaatgccatcttgacgacattcaacgaaatc
aacatggcgcccgttatggaaatgcgcaagcgcttccaagacaagtttgaaaaagaacac
ggcattaagttgggcttcatgagcttcttcgtcaaagctgcggttcatgctttgaagaag
ttccctgtgctcaatgcatccgttgacggcaacgacatcgtttaccacggctacttcgac
attggtattgctgtaggttcaccccgcggtttggtggtacctattttgcgcaacgccgat
caaatgagctttgccgacatcgagaagaaaattgctgagtttggtgcaaaagccaaagac
ggcaagttgggcattgaagacatgaccggcggtacgttctccatctccaatggcggcacc
ttcggctccatgatgtccacccccatcatcaacccaccccagtctgccatcttgggtgtg
cacgccacaaaagatcgcgccatggttgaaaacggtcaagtcgtggttcgccccatgaac
tatttcgccatgtcttacgaccaccgcatcattgacggccgtgaagctgtcttgggcttg
gtggccatgaaagaagcgttggaagatccatcacgcttgttgtttgacatctaa

DBGET integrated database retrieval system