KEGG   Limnohabitans sp. 103DPR2: L103DPR2_01984Help
Entry
L103DPR2_01984    CDS       T04120                                 

Gene name
idnD
Definition
(GenBank) L-idonate 5-dehydrogenase (NAD(P)(+))
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
lim  Limnohabitans sp. 103DPR2
Brite
KEGG Orthology (KO) [BR:lim00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    L103DPR2_01984 (idnD)
Enzymes [BR:lim01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     L103DPR2_01984 (idnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Methyltransf_25 Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: ALK92379
UniProt: A0A0P0MH48
LinkDB All DBs
Position
2053454..2054494
Genome map
AA seq 346 aa AA seqDB search
MRALICHSAKDLRIETTELPAMGPDQVRVKVAFGGICGSDLHYYQHGGFGTVRIKQPMAL
GHEISGVVDGLGANVKHLAVGQRIAISPSRPCGSCRYCQLGQQNHCLHMRFFGSAMPFPH
IQGAFAEQLIIEGYQAHPIGAHLSLSEAALAEPLSVGLHAIQRAGGVLGKQVFVSGCGPI
GSLLIGALRRAGAARIVAADIADLPLKCAQEMGADETINLKTQPELLEKYKVDKGQFEAV
FEASGSEPALRAGLDVIMPRGVLVSVGMGGDMSIPMTQLVAKEVDLRGTFRFHAEFANAV
QFLNSGLINGKPVITGILPMDKAVDAFELACDKSQSLKVQIDFEVV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcactgatctgccactccgccaaagatttaagaattgaaaccactgaactgccc
gccatggggccggaccaagttcgcgtcaaagttgcctttggtggtatttgtggttccgat
ttgcattactaccaacacggtggttttggcacggttcgcatcaagcagccgatggcctta
ggccacgaaatttcaggcgtggtggatggcctgggtgccaacgtgaagcatctggccgtc
ggtcaacgcattgccatttctccgtcgcgaccttgcggttcatgccgctactgccaattg
ggtcagcaaaaccattgcctccacatgcgcttctttggcagcgccatgcccttcccccac
attcaaggtgcatttgctgagcagctcatcatcgaaggctatcaagcgcatcccatcggt
gcacaccttagcctttcggaggctgccttggccgagcccttgtctgttggcttgcacgcc
atccaacgtgctggcggcgtgttgggcaagcaagtgtttgtctctggctgcggccccatt
ggatccttgctgatcggcgcattgcgtcgtgcaggagcggcccgcattgtggccgccgac
attgccgacctgcccttgaagtgcgctcaagagatgggtgccgatgaaaccatcaacctc
aagacgcaacctgagttgctcgaaaaatacaaagttgacaaaggccagtttgaagctgtc
tttgaagcctctggcagtgaacccgctttgcgtgcgggtctggatgtcatcatgccgcgc
ggcgtgttggtctctgtgggcatgggtggcgacatgagcattccaatgacccaactggtt
gccaaagaggtggacctgcgcggtaccttccgattccatgcagagtttgccaatgccgtt
caattcctcaattcaggtttgatcaatggcaaacctgtgatcacgggcatcttgcccatg
gacaaagcggtggatgcctttgaactggcttgcgacaaatcgcaatccttgaaagttcaa
atcgacttcgaagtcgtttga

DBGET integrated database retrieval system