KEGG   Limnohabitans sp. 103DPR2: L103DPR2_02400Help
Entry
L103DPR2_02400    CDS       T04120                                 

Gene name
sdhA
Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
lim  Limnohabitans sp. 103DPR2
Pathway
lim00020  Citrate cycle (TCA cycle)
lim00190  Oxidative phosphorylation
lim00650  Butanoate metabolism
lim01100  Metabolic pathways
lim01110  Biosynthesis of secondary metabolites
lim01120  Microbial metabolism in diverse environments
lim01130  Biosynthesis of antibiotics
lim01200  Carbon metabolism
Module
lim_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lim_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lim_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:lim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    L103DPR2_02400 (sdhA)
   00650 Butanoate metabolism
    L103DPR2_02400 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    L103DPR2_02400 (sdhA)
Enzymes [BR:lim01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     L103DPR2_02400 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     L103DPR2_02400 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 DAO FAD_binding_3 GIDA HI0933_like Pyr_redox_3 FAD_oxidored NAD_binding_7 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ALK92782
UniProt: A0A0P0MHN3
LinkDB All DBs
Position
2480770..2482575
Genome map
AA seq 601 aa AA seqDB search
MTYTKDKIATRKFDVVIVGAGGSGMRASLQLARAGLNVAVLSKVFPTRSHTVAAQGGIGA
SLGNMSDDNWHYHFYDTIKGSDWLGDQDAIEFMCREAPKVVYDLEHMGMPFDRNPDGTIY
QRPFGGHTANYGEKPVQRACAAADRTGHAMLHTLYQQNVKAKTSFFVEWMALDLIRDAEG
DVVGVTALEMETGDLHILHAKTVLLATGGAGRIFAASTNAFINTGDGLGMAARAGIPLED
MEFWQFHPTGVAGAGVLLTEGCRGEGAILLNSNGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGCGPNKDYVLLKLDHLGAETIHKRLPSVYEIGVNFANVDITKEPIPVVPTIHYQ
MGGIPTNVHGQVVTQTASSHNAVVNGLYAVGECSCVSVHGANRLGTNSLLDLLVFGRAAG
NHIVDFASKTKAHKDLPKDAADFTLARLNRLEGRKGEYAQDVANDMRATMQKHAAVFRTQ
ASMDEGVQKIAEIRERVNTIGLTDNSKVFNTARIEALEVDNLIECAQSTMVSAAARKECR
GAHTVSDYERPADDPIAPLGRDDANWMKHTLWHSESNSLTYKPVNLKPLTVDSVPPKVRT
F
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgacttacaccaaagacaagatcgccacgcgtaaatttgacgtcgtgatcgtcggcgca
ggcggctccggcatgcgcgcttcattgcaactggcacgtgccggtttgaacgttgctgtt
ctctccaaagtattccccacacgctcacacactgtggccgcacaaggtggtattggcgct
tcattgggcaacatgtccgatgacaactggcactaccacttctacgacaccatcaagggt
tctgactggctgggcgaccaagacgccatcgaattcatgtgccgcgaagcacccaaggtg
gtgtacgaccttgaacacatgggcatgccctttgaccgcaacccagacggcaccatttac
caacgtccttttggcggtcacaccgccaactatggcgaaaagcctgtgcagcgtgcttgc
gctgcggccgaccgtaccggtcacgccatgttgcacaccttgtaccaacaaaacgtcaaa
gccaaaaccagcttcttcgtggagtggatggcccttgacttgatccgcgacgccgaaggc
gatgtggtgggcgtcactgccctcgaaatggaaacaggcgacttgcacatcttgcatgcc
aagactgtgttgttggccaccggcggcgcaggccgtatctttgcagcttcaaccaatgcc
ttcatcaataccggcgacggattgggcatggcagcgcgtgctggcattcctttggaagac
atggaattctggcagttccaccccactggcgtggccggtgccggtgtgttgctgacagag
ggttgccgcggtgaaggcgccattttgttgaacagcaatggcgaacgtttcatggagcgc
tatgcgcctacattgaaagacttggcccctcgcgacttcgtgtcacgctctatggaccaa
gagatcaaagaaggccgtggttgcggccccaacaaagactatgtgctgttgaaactggac
cacttgggtgcagaaaccattcacaagcgcttgccttctgtgtacgaaattggcgtcaac
ttcgccaatgtcgacatcaccaaagaacccattcctgtggtgccgaccatccactatcaa
atgggcggcattcccaccaacgtccacggccaagtggtcacgcaaacggccagcagccac
aacgccgtggtcaatggcttgtacgctgtgggcgaatgctcttgcgtcagcgttcacggc
gccaaccgcttgggcaccaactctttgctcgacttgttggtgtttggtcgcgcagccggc
aaccacattgttgactttgccagcaaaaccaaagcgcacaaagatttgccgaaagacgca
gccgacttcacgctggcgcgcctcaaccgcctcgaaggtcgcaaaggcgaatacgcccaa
gatgtggccaacgacatgcgcgcaacgatgcaaaaacatgctgctgtgttccgcacacag
gccagcatggacgaaggcgtgcaaaaaattgccgagattcgcgagcgcgtcaataccatt
ggtttgaccgacaactccaaagtcttcaacacagcccgtattgaagccttggaagttgac
aacttgatcgagtgcgctcaatccaccatggtgtctgctgccgctcgcaaggaatgccgc
ggcgctcacaccgtgagcgattacgagcgtccagccgatgatccgatcgcacccttgggc
cgcgacgatgccaattggatgaaacacaccttgtggcacagcgaaagcaacagcctgact
tacaagcccgtcaacttgaaaccgctgactgtggactctgtgccacccaaagtccgtacg
ttctaa

DBGET integrated database retrieval system