KEGG   Listeria innocua (serotype 6a): ddlAHelp
Entry
ddlA              CDS       T00067                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lin  Listeria innocua (serotype 6a)
Pathway
lin00473  D-Alanine metabolism
lin00550  Peptidoglycan biosynthesis
lin01100  Metabolic pathways
lin01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lin00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ddlA
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ddlA
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    ddlA
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lin01011]
    ddlA
Enzymes [BR:lin01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ddlA
Peptidoglycan biosynthesis and degradation proteins [BR:lin01011]
 Precursor biosynthesis
  Amino acid ligase
   ddlA
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST DUF2922
Motif
Other DBs
NCBI-ProteinID: CAC96080
Pasteur: LIN00848
UniProt: Q92DG5
LinkDB All DBs
Position
881610..882722
Genome map
AA seq 370 aa AA seqDB search
MKTKLILLYGGKSAEHEVSLQTAFSVINALDLEKFEAEPIYITNEGEWVQGPLLSGKLDF
VEQLRFSATDRVKLATAESEKSEGEAISPAVLEADGQETVVFPLLHGPNGEDGTVQGLFE
VLNIPYVGNGVLASSAAMDKIVMKKIFADAGIPQVPAVAVRLIDWKNYQEEMVTEMEEVL
TYPVFVKPANLGSSVGISKATNKTELIEAMTEAFLYDRRVVVEQGVVAREIEMGVLGNDT
PVCSVPGEILPEGAVAKFYDYKAKYQDNNTALIIPTEVEPEILEQMKEYAVQAFLGLDAS
GLVRADFFLTEDNQLFLNEVNTMPGFTPYSMYPLLWQETGLPYGALIERLVDLAKERHAA
KNALKYKLED
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaagttaattttattatacggtggaaaatctgctgaacacgaggtttcttta
caaacagcattttcagtaatcaatgctttagatttagaaaaatttgaagctgaaccaata
tatattacaaatgaaggtgagtgggttcaaggaccgctactttctggaaaattagatttt
gtcgagcaattacgtttctcggctacagatagagtgaaacttgctacagctgaatcagaa
aaatcagaaggggaagcaattagcccagctgttttagaagctgacggacaagaaacagtt
gtattcccacttttacatggtccaaacggagaagatggaactgttcaaggcttattcgaa
gttttaaatattccttacgttggcaatggtgtcctagcttcatcagcagcaatggataaa
atcgtgatgaagaaaatttttgcagatgctggtattccacaagttccagcagttgcggtg
cgtttaattgattggaaaaactatcaagaggaaatggttactgaaatggaagaagtgctt
acatatccagtcttcgtaaaaccagcgaatcttggttcaagtgttggtattagtaaagca
acgaataaaacagaattaattgaagcgatgacagaagcatttttatacgaccgtcgtgtt
gttgttgaacaaggtgtggttgctcgtgagatcgaaatgggcgtgcttggaaatgatacg
ccagtttgctcagttccaggagaaatcttgccagaaggtgcagttgctaagttttatgat
tacaaagcaaaatatcaagacaacaacactgcattaattattccaacagaagtagaaccg
gaaattttagaacaaatgaaagaatatgcagttcaagctttcttaggtcttgatgcaagc
gggctcgtgcgtgctgactttttcttaacggaagataatcagttgttcttaaatgaagta
aatacaatgcctggtttcacaccatatagcatgtatccactactttggcaggaaactggc
ttaccatacggagcgctaattgaacgattagttgatttggcaaaagaacgccacgcagct
aaaaatgcacttaaatataaattagaagactaa

DBGET integrated database retrieval system